224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | G-protein coupled receptor 55 |
|---|
Gene and Protein Information
| Gene ID | 9290 |
|---|---|
| Uniprot Accession IDs | Q9Y2T6 Q8N580 |
| Ensembl ID | ENSP00000375894 |
| Symbol | LPIR1 |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence | MSQQNTSGDCLFDGVNELMKTLQFAVHIPTFVLGLLLNLLAIHGFSTFLKNRWPDYAATSIYMINLAVFDLLLVLSLPFKMVLSQVQSPFPSLCTLVECLYFVSMYGSVFTICFISMDRFLAIRYPLLVSHLRSPRKIFGICCTIWVLVWTGSIPIYSFHGKVEKYMCFHNMSDDTWSAKVFFPLEVFGFLLPMGIMGFCCSRSIHILLGRRDHTQDWVQQKACIYSIAASLAVFVVSFLPVHLGFFLQFLVRNSFIVECRAKQSISFFLQLSMCFSNVNCCLDVFCYYFVIKEFRMNIRAHRPSRVQLVLQDTTISRG Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 470673 | GPR55 | G protein-coupled receptor 55 | 9598 | VGNC:10832 | OMA, EggNOG |
| Mouse | 227326 | Gpr55 | G protein-coupled receptor 55 | 10090 | MGI:2685064 | Inparanoid, OMA, EggNOG |
| Rat | 501177 | Gpr55 | G protein-coupled receptor 55 | 10116 | RGD:1559828 | Inparanoid, OMA, EggNOG |
| Dog | 486157 | GPR55 | G protein-coupled receptor 55 | 9615 | VGNC:41438 | Inparanoid, OMA, EggNOG |
| Horse | GPR55 | G protein-coupled receptor 55 [Source:HGNC Symbol;Acc:HGNC:4511] | 9796 | OMA, EggNOG | ||
| Cow | 539107 | GPR55 | G protein-coupled receptor 55 | 9913 | VGNC:29591 | Inparanoid, OMA, EggNOG |
| Opossum | 100021880 | GPR55 | G protein-coupled receptor 55 | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 770641 | GPR55 | G protein-coupled receptor 55 | 9031 | CGNC:4131 | Inparanoid, OMA, EggNOG |
| Xenopus | gpr55 | G protein-coupled receptor 55 [Source:Xenbase;Acc:XB-GENE-1011165] | 8364 | OMA, EggNOG |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / G-protein coupled receptor 55
protein / G-protein coupled receptor / Class A rhodopsin like / G-protein coupled receptor 55
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.