🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

SLC5A4

DescripciónSolute carrier family 5 member 4

Gene and Protein Information

Gene ID6527
Uniprot Accession IDs Q9NY91 O15279
Ensembl ID ENSP00000266086
Symbol SAAT1 SGLT3 SAAT1 SGLT3 DJ90G24.4
FamilyBelongs to the sodium:solute symporter (SSF) (TC 2.A.21) family.
Sequence
MASTVSPSTIAETPEPPPLSDHIRNAADISVIVIYFLVVMAVGLWAMLKTNRGTIGGFFLAGRDMAWWPMGASLFASNIGSNHYVGLAGTGAASGVATVTFEWTSSVMLLILGWIFVPIYIKSGVMTMPEYLKKRFGGERLQVYLSILSLFICVVLLISADIFAGAIFIKLALGLDLYLAIFILLAMTAVYTTTGGLASVIYTDTLQTIIMLIGSFILMGFAFNEVGGYESFTEKYVNATPSVVEGDNLTISASCYTPRADSFHIFRDAVTGDIPWPGIIFGMPITALWYWCTNQVIVQRCLCGKDMSHVKAACIMCAYLKLLPMFLMVMPGMISRILYTDMVACVVPSECVKHCGVDVGCTNYAYPTMVLELMPQGLRGLMLSVMLASLMSSLTSIFNSASTLFTIDLYTKMRKQASEKELLIAGRIFVLLLTVVSIVWVPLVQVSQNGQLIHYTESISSYLGPPIAAVFVLAIFCKRVNEQGAFWGLMVGLAMGLIRMITEFAYGTGSCLAPSNCPKIICGVHYLYFSIVLFFGSMLVTLGISLLTKPIPDVHLYRLCWVLRNSTEERIDIDAEEKSQEETDDGVEEDYPEKSRGCLKKAYDLFCGLQKGPKLTKEEEEALSKKLTDTSERPSWRTIVNINAILLLAVVVFIHGYYA
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp470189SLC5A4solute carrier family 5 member 49598VGNC:7805OMA, EggNOG
Macaque717137SLC5A4solute carrier family 5 member 49544Inparanoid, OMA, EggNOG
Mouse64452Slc5a4asolute carrier family 5, member 4a10090MGI:1927848Inparanoid, OMA
Rat294341Slc5a4solute carrier family 5 member 410116RGD:1306923Inparanoid, OMA
Dog100685907SLC5A4solute carrier family 5 member 49615VGNC:46447Inparanoid, OMA, EggNOG
Horse100058200SLC5A4solute carrier family 5 member 49796VGNC:52440Inparanoid, OMA
Cow527441SLC5A4solute carrier family 5 member 49913VGNC:34907Inparanoid, OMA, EggNOG
Pig397376SLC5A4solute carrier family 5 member 49823Inparanoid, OMA, EggNOG
Opossum100028976LOC100028976low affinity sodium-glucose cotransporter-like13616OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    transporter    /    carbohydrate transporter    /    Solute carrier family 5 member 4
protein    /    transporter    /    cation transporter    /    Solute carrier family 5 member 4
DTO Classes
protein    /    Transporter    /    SLC superfamily of solute carriers    /    SLC5 family of sodium-dependent glucose transporters    /    Hexose transporter family    /    Solute carrier family 5 member 4

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.