Alternar navegación 
Buscar
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock
| Descripción | Tetranectin |
|---|
Gene and Protein Information
| Gene ID | 7123 |
|---|---|
| Uniprot Accession IDs | P05452 Q6FGX6 TN |
| Ensembl ID | ENSP00000296130 |
| Symbol | TNA TN TNA |
| Sequence | MELWGAYLLLCLFSLLTQVTTEPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVCLKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLGTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIV |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 21922 | Clec3b | C-type lectin domain family 3, member b | 10090 | MGI:104540 | Inparanoid, OMA |
| Dog | 609596 | CLEC3B | C-type lectin domain family 3 member B | 9615 | VGNC:54591 | Inparanoid, OMA |
| Horse | 100630686 | CLEC3B | C-type lectin domain family 3 member B | 9796 | VGNC:16604 | Inparanoid, OMA |
| Cow | 515783 | CLEC3B | C-type lectin domain family 3 member B | 9913 | VGNC:27429 | Inparanoid, OMA, EggNOG |
| Opossum | 100619037 | CLEC3B | C-type lectin domain family 3 member B | 13616 | Inparanoid, OMA | |
| Platypus | 100082712 | CLEC3B | C-type lectin domain family 3 member B | 9258 | Inparanoid, OMA | |
| Anole lizard | 100559163 | clec3b | C-type lectin domain family 3 member B | 28377 | Inparanoid, OMA | |
| Xenopus | 496907 | clec3b | C-type lectin domain family 3 member B | 8364 | XB-GENE-945743 | Inparanoid, OMA, EggNOG |
| Zebrafish | 572488 | clec3ba | C-type lectin domain family 3, member Ba | 7955 | ZDB-GENE-110411-71 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / extracellular matrix protein / extracellular matrix structural protein / Tetranectin
protein / extracellular matrix protein / extracellular matrix structural protein / Tetranectin
DTO Classes
protein / Extracellular structure / Extracellular matrix structural protein / Tetranectin
protein / Extracellular structure / Extracellular matrix structural protein / Tetranectin
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Especificaciones | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Recordármelo más tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.