224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | SH2 domain-containing adapter protein B |
|---|
Gene and Protein Information
| Gene ID | 6461 |
|---|---|
| Uniprot Accession IDs | Q15464 B9EGM0 D3DRQ5 Q504U5 Q5VUM8 |
| Ensembl ID | ENSP00000366936 |
| Symbol | bA3J10.2 |
| Sequence | MAKWLNKYFSLGNSKTKSPPQPPRPDYREQRRRGERPSQPPQAVPQASSAASASCGPATASCFSASSGSLPDDSGSTSDLIRAYRAQKERDFEDPYNGPGSSLRKLRAMCRLDYCGGSGEPGGVQRAFSASSASGAAGCCCASSGAGAAASSSSSSGSPHLYRSSSERRPATPAEVRYISPKHRLIKVESAAGGGAGDPLGGACAGGRTWSPTACGGKKLLNKCAASAAEESGAGKKDKVTIADDYSDPFDAKNDLKSKAGKGESAGYMEPYEAQRIMTEFQRQESVRSQHKGIQLYDTPYEPEGQSVDSDSESTVSPRLRESKLPQDDDRPADEYDQPWEWNRVTIPALAAQFNGNEKRQSSPSPSRDRRRQLRAPGGGFKPIKHGSPEFCGILGERVDPAVPLEKQIWYHGAISRGDAENLLRLCKECSYLVRNSQTSKHDYSLSLRSNQGFMHMKLAKTKEKYVLGQNSPPFDSVPEVIHYYTTRKLPIKGAEHLSLLYPVAVRTL Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 465107 | SHB | SH2 domain containing adaptor protein B | 9598 | VGNC:10058 | OMA, EggNOG |
| Macaque | 716169 | SHB | SH2 domain containing adaptor protein B | 9544 | OMA, EggNOG | |
| Mouse | 230126 | Shb | src homology 2 domain-containing transforming protein B | 10090 | MGI:98294 | Inparanoid, OMA, EggNOG |
| Rat | 362513 | Shb | SH2 domain containing adaptor protein B | 10116 | RGD:1565350 | Inparanoid, OMA, EggNOG |
| Dog | 481619 | SHB | SH2 domain containing adaptor protein B | 9615 | VGNC:46138 | Inparanoid, OMA, EggNOG |
| Cow | 538275 | SHB | SH2 domain containing adaptor protein B | 9913 | VGNC:34588 | Inparanoid, OMA, EggNOG |
| Xenopus | 100489262 | shb | Src homology 2 domain containing adaptor protein B | 8364 | XB-GENE-6258291 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.