224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | SAM domain-containing protein SAMSN-1 |
|---|
Gene and Protein Information
| Gene ID | 64092 |
|---|---|
| Uniprot Accession IDs | Q9NSI8 B3KWJ3 F8WAA1 Q8NFF7 Q9C041 |
| Ensembl ID | ENSP00000285670 |
| Symbol | HACS1 SLy2 HACS1 NASH1 SASH2 SH3D6B |
| Sequence | MLKRKPSNVSEKEKHQKPKRSSSFGNFDRFRNNSLSKPDDSTEAHEGDPTNGSGEQSKTSNNGGGLGKKMRAISWTMKKKVGKKYIKALSEEKDEEDGENAHPYRNSDPVIGTHTEKVSLKASDSMDSLYSGQSSSSGITSCSDGTSNRDSFRLDDDGPYSGPFCGRARVHTDFTPSPYDTDSLKIKKGDIIDIICKTPMGMWTGMLNNKVGNFKFIYVDVISEEEAAPKKIKANRRSNSKKSKTLQEFLERIHLQEYTSTLLLNGYETLEDLKDIKESHLIELNIENPDDRRRLLSAAENFLEEEIIQEQENEPEPLSLSSDISLNKSQLDDCPRDSGCYISSGNSDNGKEDLESENLSDMVHKIIITEPSD Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 458470 | SAMSN1 | SAM domain, SH3 domain and nuclear localization signals 1 | 9598 | VGNC:14831 | OMA, EggNOG |
| Macaque | 694064 | SAMSN1 | SAM domain, SH3 domain and nuclear localization signals 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 67742 | Samsn1 | SAM domain, SH3 domain and nuclear localization signals, 1 | 10090 | MGI:1914992 | Inparanoid, OMA, EggNOG |
| Rat | 170637 | Samsn1 | SAM domain, SH3 domain and nuclear localization signals, 1 | 10116 | RGD:620926 | Inparanoid, OMA, EggNOG |
| Dog | 608104 | SAMSN1 | SAM domain, SH3 domain and nuclear localization signals 1 | 9615 | VGNC:45857 | Inparanoid, OMA, EggNOG |
| Horse | 100068667 | SAMSN1 | SAM domain, SH3 domain and nuclear localization signals 1 | 9796 | VGNC:52432 | Inparanoid, OMA, EggNOG |
| Cow | 534171 | SAMSN1 | SAM domain, SH3 domain and nuclear localization signals 1 | 9913 | VGNC:34279 | Inparanoid, OMA, EggNOG |
| Opossum | 100011912 | SAMSN1 | SAM domain, SH3 domain and nuclear localization signals 1 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | SAMSN1 | SAM domain, SH3 domain and nuclear localization signals 1 [Source:HGNC Symbol;Acc:HGNC:10528] | 9258 | OMA, EggNOG | ||
| Anole lizard | 100568060 | samsn1 | SAM domain, SH3 domain and nuclear localization signals 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | samsn1 | SAM domain, SH3 domain and nuclear localization signals 1 [Source:Xenbase;Acc:XB-GENE-993010] | 8364 | OMA, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.