224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Stromal cell-derived factor 1 |
|---|
Gene and Protein Information
| Gene ID | 6387 |
|---|---|
| Uniprot Accession IDs | P48061 B2R4G0 E7EVL0 H7BYN8 Q2L985 Q2L986 Q2L988 Q5IT36 Q6ICW0 Q9H554 SDF-1 |
| Ensembl ID | ENSP00000379140 |
| Symbol | SDF1 SDF1A SDF1B IRH PBSF SDF1 TLSF TPAR1 SCYB12 |
| Family | Belongs to the intercrine alpha (chemokine CxC) family. |
| Sequence | MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 20315 | Cxcl12 | chemokine (C-X-C motif) ligand 12 | 10090 | MGI:103556 | Inparanoid, OMA, EggNOG |
| Rat | 24772 | Cxcl12 | C-X-C motif chemokine ligand 12 | 10116 | RGD:3651 | Inparanoid, OMA, EggNOG |
| Horse | 100049872 | CXCL12 | C-X-C motif chemokine ligand 12 | 9796 | VGNC:16983 | Inparanoid, OMA, EggNOG |
| Cow | 613811 | CXCL12 | C-X-C motif chemokine ligand 12 | 9913 | VGNC:27848 | Inparanoid, OMA, EggNOG |
| Pig | 494460 | CXCL12 | C-X-C motif chemokine ligand 12 | 9823 | Inparanoid, EggNOG | |
| Opossum | 100016207 | CXCL12 | C-X-C motif chemokine ligand 12 | 13616 | Inparanoid, EggNOG | |
| Platypus | 100082099 | CXCL12 | C-X-C motif chemokine ligand 12 | 9258 | Inparanoid, OMA, EggNOG | |
| Anole lizard | CXCL12 | C-X-C motif chemokine ligand 12 [Source:HGNC Symbol;Acc:HGNC:10672] | 28377 | Inparanoid, EggNOG | ||
| Xenopus | 548481 | cxcl12 | C-X-C motif chemokine ligand 12 | 8364 | XB-GENE-919853 | Inparanoid, OMA, EggNOG |
| Zebrafish | 799354 | cxcl12b | chemokine (C-X-C motif) ligand 12b (stromal cell-derived factor 1) | 7955 | ZDB-GENE-030721-1 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.