🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

SCAMP5

DescripciónSecretory carrier-associated membrane protein 5

Gene and Protein Information

Gene ID192683
Uniprot Accession IDs Q8TAC9 B3KPJ7 B7Z762 D3DW71 Q8N3M4 Secretory carrier membrane protein 5
Ensembl ID ENSP00000355387
FamilyBelongs to the SCAMP family. SCAMP5 subfamily.
Sequence
MAEKVNNFPPLPKFIPLKPCFYQDFEADIPPQHVSMTKRLYYLWMLNSVTLAVNLVGCLAWLIGGGGATNFGLAFLWLILFTPCSYVCWFRPIYKAFKTDSSFSFMAFFFTFMAQLVISIIQAVGIPGWGVCGWIATISFFGTNIGSAVVMLIPTVMFTVMAVFSFIALSMVHKFYRGSGGSFSKAQEEWTTGAWKNPHVQQAAQNAAMGAAQGAMNQPQTQYSATPNYTYSNEM
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp453752SCAMP5secretory carrier membrane protein 59598VGNC:1880OMA, EggNOG
Macaque710454SCAMP5secretory carrier membrane protein 59544Inparanoid, OMA, EggNOG
Mouse56807Scamp5secretory carrier membrane protein 510090MGI:1928948Inparanoid, OMA, EggNOG
Rat65171Scamp5secretory carrier membrane protein 510116RGD:68356Inparanoid, OMA
Dog478371SCAMP5secretory carrier membrane protein 59615VGNC:45893Inparanoid, OMA, EggNOG
Horse100061807SCAMP5secretory carrier membrane protein 59796VGNC:22712Inparanoid, OMA, EggNOG
Cow508510SCAMP5secretory carrier membrane protein 59913VGNC:34319Inparanoid, OMA, EggNOG
Pig100156508SCAMP5secretory carrier membrane protein 59823OMA, EggNOG
Opossum100030150SCAMP5secretory carrier membrane protein 513616Inparanoid, EggNOG
Chicken426413SCAMP5secretory carrier membrane protein 59031CGNC:10531Inparanoid, OMA, EggNOG
Anole lizard100554908scamp5secretory carrier membrane protein 528377Inparanoid, OMA, EggNOG
Xenopus779947scamp5secretory carrier membrane protein 58364XB-GENE-1006975Inparanoid, OMA, EggNOG
Zebrafish324467scamp5asecretory carrier membrane protein 5a7955ZDB-GENE-030131-3188Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.