Alternar navegación 
Buscar
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock
| Descripción | Neuronal-specific septin-3 |
|---|
Gene and Protein Information
| Gene ID | 55964 |
|---|---|
| Uniprot Accession IDs | Q9UH03 B1AHR0 Q2NKJ7 Q59GF7 Q6IBZ6 Q8N3P3 Q9HD35 |
| Ensembl ID | ENSP00000379704 |
| Symbol | SEP3 SEP3 bK250D10.3 |
| Family | Belongs to the TRAFAC class TrmE-Era-EngA-EngB-Septin-like GTPase superfamily. Septin GTPase family. |
| Sequence | MSKGLPETRTDAAMSELVPEPRPKPAVPMKPMSINSNLLGYIGIDTIIEQMRKKTMKTGFDFNIMVVGQSGLGKSTLVNTLFKSQVSRKASSWNREEKIPKTVEIKAIGHVIEEGGVKMKLTVIDTPGFGDQINNENCWEPIEKYINEQYEKFLKEEVNIARKKRIPDTRVHCCLYFISPTGHSLRPLDLEFMKHLSKVVNIIPVIAKADTMTLEEKSEFKQRVRKELEVNGIEFYPQKEFDEDLEDKTENDKIRQESMPFAVVGSDKEYQVNGKRVLGRKTPWGIIEVENLNHCEFALLRDFVIRTHLQDLKEVTHNIHYETYRAKRLNDNGGLPPGEGLLGTVLPPVPATPCPTAE Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 458874 | SEPT3 | septin 3 | 9598 | VGNC:6010 | OMA, EggNOG |
| Macaque | 712931 | SEPT3 | septin 3 | 9544 | OMA, EggNOG | |
| Mouse | 24050 | Sept3 | septin 3 | 10090 | MGI:1345148 | Inparanoid, OMA, EggNOG |
| Rat | 56003 | Sept3 | septin 3 | 10116 | RGD:621745 | Inparanoid, OMA, EggNOG |
| Dog | 481227 | SEPT3 | septin 3 | 9615 | VGNC:49646 | Inparanoid, OMA |
| Cow | 618235 | SEPT3 | septin 3 | 9913 | VGNC:34455 | Inparanoid, OMA, EggNOG |
| Pig | 100157034 | SEPT3 | septin 3 | 9823 | Inparanoid, OMA, EggNOG | |
| Platypus | SEPT3 | septin 3 [Source:HGNC Symbol;Acc:HGNC:10750] | 9258 | OMA, EggNOG | ||
| Chicken | 427899 | SEPT3 | septin 3 | 9031 | CGNC:9033 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100558345 | sept3 | septin 3 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | sept3 | septin 3 [Source:Xenbase;Acc:XB-GENE-1002286] | 8364 | OMA, EggNOG | ||
| Zebrafish | 554123 | sept3 | septin 3 | 7955 | ZDB-GENE-050522-375 | Inparanoid, OMA |
| S.cerevisiae | 850358 | CDC10 | septin CDC10 | 4932 | S000000595 | OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / enzyme modulator / small GTPase / Neuronal-specific septin-3
protein / enzyme modulator / cytoskeletal protein / Neuronal-specific septin-3
protein / enzyme modulator / small GTPase / Neuronal-specific septin-3
protein / enzyme modulator / cytoskeletal protein / Neuronal-specific septin-3
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Especificaciones | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Recordármelo más tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.