224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Taste receptor type 2 member 38 |
|---|
Gene and Protein Information
| Gene ID | 5726 |
|---|---|
| Uniprot Accession IDs | P59533 A4D1U6 P59552 Q2M3E8 Q645W3 Q86UK3 T2R38 |
| Ensembl ID | ENSP00000448219 |
| Symbol | PTC PTC T2R38 T2R61 THIOT |
| Family | Belongs to the G-protein coupled receptor T2R family. |
| Sequence | MLTLTRIRTVSYEVRSTFLFISVLEFAVGFLTNAFVFLVNFWDVVKRQALSNSDCVLLCLSISRLFLHGLLFLSAIQLTHFQKLSEPLNHSYQAIIMLWMIANQANLWLAACLSLLYCSKLIRFSHTFLICLASWVSRKISQMLLGIILCSCICTVLCVWCFFSRPHFTVTTVLFMNNNTRLNWQIKDLNLFYSFLFCYLWSVPPFLLFLVSSGMLTVSLGRHMRTMKVYTRNSRDPSLEAHIKALKSLVSFFCFFVISSCAAFISVPLLILWRDKIGVMVCVGIMAACPSGHAAILISGNAKLRRAVMTILLWAQSSLKVRADHKADSRTLC Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 493889 | TAS2R38 | taste 2 receptor member 38 | 9598 | VGNC:8771 | Inparanoid, OMA |
| Macaque | 695549 | TAS2R38 | taste 2 receptor member 38 | 9544 | Inparanoid, OMA | |
| Mouse | 387513 | Tas2r138 | taste receptor, type 2, member 138 | 10090 | MGI:2681306 | Inparanoid, OMA |
| Dog | 100271737 | TAS2R38 | taste 2 receptor member 38 | 9615 | VGNC:47117 | Inparanoid, OMA |
| Horse | 106783090 | TAS2R38 | taste 2 receptor member 38 | 9796 | VGNC:23881 | Inparanoid, OMA |
| Cow | 787789 | TAS2R38 | taste 2 receptor member 38 | 9913 | VGNC:35612 | Inparanoid, OMA |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Taste 2 receptor / Taste receptor type 2 member 38
protein / G-protein coupled receptor / Class A rhodopsin like / Taste 2 receptor / Taste receptor type 2 member 38
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.