224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Taste receptor type 2 member 39 |
|---|
Gene and Protein Information
| Gene ID | 259285 |
|---|---|
| Uniprot Accession IDs | P59534 A4FUI7 Q3ZCN6 Q645W4 T2R39 |
| Ensembl ID | ENSP00000405095 |
| Symbol | T2R39 T2R57 |
| Family | Belongs to the G-protein coupled receptor T2R family. |
| Sequence | MLGRCFPPDTKEKQQLRMTKLCDPAESELSPFLITLILAVLLAEYLIGIIANGFIMAIHAAEWVQNKAVSTSGRILVFLSVSRIALQSLMMLEITISSTSLSFYSEDAVYYAFKISFIFLNFCSLWFAAWLSFFYFVKIANFSYPLFLKLRWRITGLIPWLLWLSVFISFSHSMFCINICTVYCNNSFPIHSSNSTKKTYLSEINVVGLAFFFNLGIVTPLIMFILTATLLILSLKRHTLHMGSNATGSNDPSMEAHMGAIKAISYFLILYIFNAVALFIYLSNMFDINSLWNNLCQIIMAAYPASHSILLIQDNPGLRRAWKRLQLRLHLYPKEWTL Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 472612 | TAS2R39 | taste 2 receptor member 39 | 9598 | VGNC:8772 | OMA, EggNOG |
| Mouse | 353148 | Tas2r139 | taste receptor, type 2, member 139 | 10090 | MGI:2681308 | Inparanoid, OMA, EggNOG |
| Rat | 680188 | Tas2r139 | taste receptor, type 2, member 139 | 10116 | RGD:1595436 | Inparanoid, OMA, EggNOG |
| Dog | 100271735 | TAS2R39 | taste 2 receptor member 39 | 9615 | VGNC:47118 | Inparanoid, OMA, EggNOG |
| Pig | 100621890 | TAS2R39 | taste 2 receptor member 39 | 9823 | OMA, EggNOG | |
| Opossum | 664681 | T2R39 | bitter taste receptor Modo-T2R39 | 13616 | OMA, EggNOG |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Taste 2 receptor / Taste receptor type 2 member 39
protein / G-protein coupled receptor / Class A rhodopsin like / Taste 2 receptor / Taste receptor type 2 member 39
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.