224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Taste receptor type 2 member 41 |
|---|
Gene and Protein Information
| Gene ID | 259287 |
|---|---|
| Uniprot Accession IDs | P59536 P59550 Q495I2 Q50KJ5 Q50KJ6 Q50KJ7 Q645W7 T2R41 |
| Ensembl ID | ENSP00000386201 |
| Symbol | T2R41 T2R59 |
| Family | Belongs to the G-protein coupled receptor T2R family. |
| Sequence | MQAALTAFFVLLFSLLSLLGIAANGFIVLVLGREWLRYGRLLPLDMILISLGASRFCLQLVGTVHNFYYSAQKVEYSGGLGRQFFHLHWHFLNSATFWFCSWLSVLFCVKIANITHSTFLWLKWRFPGWVPWLLLGSVLISFIITLLFFWVNYPVYQEFLIRKFSGNMTYKWNTRIETYYFPSLKLVIWSIPFSVFLVSIMLLINSLRRHTQRMQHNGHSLQDPSTQAHTRALKSLISFLILYALSFLSLIIDAAKFISMQNDFYWPWQIAVYLCISVHPFILIFSNLKLRSVFSQLLLLARGFWVA Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 472562 | TAS2R41 | taste 2 receptor member 41 | 9598 | VGNC:8775 | Inparanoid, OMA, EggNOG |
| Mouse | 387353 | Tas2r126 | taste receptor, type 2, member 126 | 10090 | MGI:2681273 | Inparanoid, OMA, EggNOG |
| Rat | 246219 | Tas2r126 | taste receptor, type 2, member 126 | 10116 | RGD:727853 | Inparanoid, OMA, EggNOG |
| Dog | 482734 | TAS2R41 | taste 2 receptor member 41 | 9615 | VGNC:49729 | Inparanoid, OMA, EggNOG |
| Pig | 100524003 | TAS2R41 | taste 2 receptor member 41 | 9823 | OMA, EggNOG | |
| Opossum | 664677 | T2R41 | bitter taste receptor Modo-T2R41 | 13616 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100335065 | t2r13 | bitter taste receptor 13 | 8364 | OMA, EggNOG |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Taste 2 receptor / Taste receptor type 2 member 41
protein / G-protein coupled receptor / Class A rhodopsin like / Taste 2 receptor / Taste receptor type 2 member 41
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.