224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Trace amine-associated receptor 1 |
|---|
Gene and Protein Information
| Gene ID | 134864 |
|---|---|
| Uniprot Accession IDs | Q96RJ0 Q2M1W5 Q3MIH8 Q5VUQ1 TaR-1 |
| Ensembl ID | ENSP00000275216 |
| Symbol | TA1 TAR1 TRAR1 TA1 TAR1 TRAR1 |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence | MMPFCHNIINISCVKNNWSNDVRASLYSLMVLIILTTLVGNLIVIVSISHFKQLHTPTNWLIHSMATVDFLLGCLVMPYSMVRSAEHCWYFGEVFCKIHTSTDIMLSSASIFHLSFISIDRYYAVCDPLRYKAKMNILVICVMIFISWSVPAVFAFGMIFLELNFKGAEEIYYKHVHCRGGCSVFFSKISGVLTFMTSFYIPGSIMLCVYYRIYLIAKEQARLISDANQKLQIGLEMKNGISQSKERKAVKTLGIVMGVFLICWCPFFICTVMDPFLHYIIPPTLNDVLIWFGYLNSTFNPMVYAFFYPWFRKALKMMLFGKIFQKDSSRCKLFLELSS Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 493908 | TAAR1 | trace amine associated receptor 1 | 9598 | VGNC:3718 | Inparanoid, OMA, EggNOG |
| Macaque | 708944 | TAAR1 | trace amine associated receptor 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 111174 | Taar1 | trace amine-associated receptor 1 | 10090 | MGI:2148258 | Inparanoid, OMA, EggNOG |
| Rat | 113914 | Taar1 | trace-amine-associated receptor 1 | 10116 | RGD:621621 | Inparanoid, OMA, EggNOG |
| Horse | 106780887 | TAAR1 | trace amine associated receptor 1 | 9796 | VGNC:23835 | Inparanoid, OMA, EggNOG |
| Cow | 104969593 | TAAR1 | trace amine associated receptor 1 | 9913 | VGNC:35553 | Inparanoid, OMA, EggNOG |
| Opossum | 100031266 | TAAR1 | trace amine associated receptor 1 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100074894 | TAAR1 | trace amine associated receptor 1 | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 768536 | TAAR1 | trace amine associated receptor 1 | 9031 | CGNC:10460 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100553388 | taar1 | trace amine associated receptor 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Zebrafish | 794715 | taar1b | trace amine associated receptor 1b | 7955 | ZDB-GENE-041014-58 | OMA, EggNOG |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Trace amine-associated receptor 1
protein / G-protein coupled receptor / Class A rhodopsin like / Trace amine-associated receptor 1
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.