The store will not work correctly when cookies are disabled.
Parece que JavaScript está deshabilitado en su navegador. Para obtener la mejor experiencia en nuestro sitio, asegúrese de activar Javascript en su navegador.
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
UBTD1 Descripción Ubiquitin domain-containing protein 1
Gene and Protein Information Gene ID 80019 Uniprot Accession IDs Q9HAC8 D3DR57 Q53HI3 Ensembl ID ENSP00000359698 Sequence MGNCVGRQRRERPAAPGHPRKRAGRNEPLKKERLKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAYAAEANDHELAQAILDGASITLPHGTLCECYDELGNRYQLPIYCLSPPVNLLLEHTEEESLEPPEPPPSVRREFPLKVRLSTGKDVRLSASLPDTVGQLKRQLHAQEGIEPSWQRWFFSGKLLTDRTRLQETKIQKDFVIQVIINQPPPPQD
Homologous gene and protein info.
Species Gene ID Gene Symbol Nombre NIF Other Gene ID Sources Chimp 743190 UBTD1 ubiquitin domain containing 1 9598 VGNC:5870 OMA, EggNOG Mouse 226122 Ubtd1 ubiquitin domain containing 1 10090 MGI:2385092 Inparanoid, OMA, EggNOG Rat 309373 Ubtd1 ubiquitin domain containing 1 10116 RGD:1308172 Inparanoid, OMA, EggNOG Dog 486821 UBTD1 ubiquitin domain containing 1 9615 VGNC:48093 Inparanoid, OMA, EggNOG Horse 100070708 UBTD1 ubiquitin domain containing 1 9796 VGNC:24751 Inparanoid, OMA, EggNOG Cow 506002 UBTD1 ubiquitin domain containing 1 9913 VGNC:36620 Inparanoid, OMA, EggNOG Pig 100156395 UBTD1 ubiquitin domain containing 1 9823 OMA, EggNOG Anole lizard 100567318 ubtd1 ubiquitin domain containing 1 28377 Inparanoid, OMA, EggNOG Xenopus 448143 ubtd1 ubiquitin domain containing 1 8364 XB-GENE-993611 Inparanoid, OMA Zebrafish 571832 ubtd1b ubiquitin domain containing 1b 7955 ZDB-GENE-050913-62 OMA, EggNOG Zebrafish 563264 ubtd1a ubiquitin domain containing 1a 7955 ZDB-GENE-070424-93 Inparanoid, OMA Fruitfly 40647 CG1172 CG1172 gene product from transcript CG1172-RC 7227 FBgn0264712 Inparanoid, EggNOG
Associated Recombinant Proteins Nombre Specification and purity Expression system Protein label Disponibilidad Mostrar detalles
Associated Antibodies
Nombre Specifications Species reactivity Aplicación Disponibilidad Mostrar detalles
Associated Approved Drugs Associated Active Ligands Associated Diseases Nombre Direct Associated Targets Disease Type Mondoid
We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our
Cookie Policy. Configuración Aceptar todo Rechazar
Shall we send you a message when we have discounts available?
Remind me later Permitir
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.