🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

UCP3

DescripciónMitochondrial uncoupling protein 3

Gene and Protein Information

Gene ID7352
Uniprot Accession IDs P55916 O60475 Q96HL3 UCP 3
Ensembl ID ENSP00000323740
Symbol SLC25A9 SLC25A9
FamilyBelongs to the mitochondrial carrier (TC 2.A.29) family.
Sequence
MVGLKPSDVPPTMAVKFLGAGTAACFADLVTFPLDTAKVRLQIQGENQAVQTARLVQYRGVLGTILTMVRTEGPCSPYNGLVAGLQRQMSFASIRIGLYDSVKQVYTPKGADNSSLTTRILAGCTTGAMAVTCAQPTDVVKVRFQASIHLGPSRSDRKYSGTMDAYRTIAREEGVRGLWKGTLPNIMRNAIVNCAEVVTYDILKEKLLDYHLLTDNFPCHFVSAFGAGFCATVVASPVDVVKTRYMNSPPGQYFSPLDCMIKMVAQEGPTAFYKGFTPSFLRLGSWNVVMFVTYEQLKRALMKVQMLRESPF
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp748551UCP3uncoupling protein 39598VGNC:10234OMA, EggNOG
Mouse22229Ucp3uncoupling protein 3 (mitochondrial, proton carrier)10090MGI:1099787Inparanoid, OMA, EggNOG
Rat25708Ucp3uncoupling protein 310116RGD:3933Inparanoid, OMA, EggNOG
Dog403575UCP3uncoupling protein 39615Inparanoid, OMA
Horse100052085UCP3uncoupling protein 39796VGNC:24768Inparanoid, OMA, EggNOG
Cow281563UCP3uncoupling protein 39913VGNC:36642Inparanoid, OMA, EggNOG
Pig397116UCP3uncoupling protein 39823Inparanoid, OMA, EggNOG
Opossum619390UCP3mitochondrial uncoupling protein 313616Inparanoid, OMA, EggNOG
Platypus100090617LOC100090617mitochondrial uncoupling protein 39258OMA, EggNOG
Chicken373896UCP3uncoupling protein 39031CGNC:48948Inparanoid, OMA

Protein Classes

DTO Classes
protein    /    Transporter    /    SLC superfamily of solute carriers    /    SLC25 family of mitochondrial transporters    /    Mitochondrial uncoupling proteins    /    Mitochondrial uncoupling protein 3

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.