Alternar navegación 
Buscar
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock
| Descripción | Synaptophysin |
|---|
Gene and Protein Information
| Gene ID | 6855 |
|---|---|
| Uniprot Accession IDs | P08247 B2R7L6 B7Z359 Q6P2F7 |
| Ensembl ID | ENSP00000263233 |
| Symbol | MRX96 MRXSYP |
| Family | Belongs to the synaptophysin/synaptobrevin family. |
| Sequence | MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYSGELQLSVDCANKTESDLSIEVEFEYPFRLHQVYFDAPTCRGGTTKVFLVGDYSSSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPMLDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEMPVCRQTGNTCKELRDPVTSGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFLRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPAGSGGSGYGPQGDYGQQGYGPQGAPTSFSNQM Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 465628 | SYP | synaptophysin | 9598 | VGNC:11628 | OMA, EggNOG |
| Macaque | 715739 | SYP | synaptophysin | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 20977 | Syp | synaptophysin | 10090 | MGI:98467 | Inparanoid, OMA, EggNOG |
| Rat | 24804 | Syp | synaptophysin | 10116 | RGD:3802 | Inparanoid, OMA |
| Dog | 612557 | SYP | synaptophysin | 9615 | VGNC:54605 | Inparanoid, OMA, EggNOG |
| Horse | 100062804 | SYP | synaptophysin | 9796 | VGNC:23812 | Inparanoid, OMA, EggNOG |
| Cow | 280937 | SYP | synaptophysin | 9913 | VGNC:35534 | Inparanoid, OMA, EggNOG |
| Pig | 100512029 | SYP | synaptophysin | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | SYP | synaptophysin [Source:HGNC Symbol;Acc:HGNC:11506] | 13616 | Inparanoid, OMA, EggNOG | ||
| Anole lizard | 100565560 | syp | synaptophysin | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100144928 | syp | synaptophysin | 8364 | XB-GENE-943861 | Inparanoid, OMA |
| Zebrafish | 559698 | sypa | synaptophysin a | 7955 | ZDB-GENE-031104-2 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / membrane traffic protein / membrane trafficking regulatory protein / Synaptophysin
protein / membrane traffic protein / membrane trafficking regulatory protein / Synaptophysin
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Especificaciones | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Recordármelo más tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.