224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Tumor protein p53-inducible nuclear protein 1 |
|---|
Gene and Protein Information
| Gene ID | 94241 |
|---|---|
| Uniprot Accession IDs | Q96A56 B2RCE5 Q969R9 |
| Ensembl ID | ENSP00000344215 |
| Symbol | P53DINP1 SIP SIP Teap p53DINP1 TP53DINP1 TP53INP1A TP53INP1B |
| Sequence | MFQRLNKMFVGEVSSSSNQEPEFNEKEDDEWILVDFIDTCTGFSAEEEEEEEDISEESPTEHPSVFSCLPASLECLADTSDSCFLQFESCPMEESWFITPPPCFTAGGLTTIKVETSPMENLLIEHPSMSVYAVHNSCPGLSEATRGTDELHSPSSPRVEAQNEMGQHIHCYVAALAAHTTFLEQPKSFRPSQWIKEHSERQPLNRNSLRRQNLTRDCHPRQVKHNGWVVHQPCPRQYNY |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 739304 | TP53INP1 | tumor protein p53 inducible nuclear protein 1 | 9598 | VGNC:777 | OMA, EggNOG |
| Macaque | TP53INP1 | tumor protein p53-inducible nuclear protein 1 [Source:RefSeq peptide;Acc:NP_001253509] | 9544 | Inparanoid, OMA, EggNOG | ||
| Mouse | 60599 | Trp53inp1 | transformation related protein 53 inducible nuclear protein 1 | 10090 | MGI:1926609 | Inparanoid, OMA, EggNOG |
| Rat | 297822 | Tp53inp1 | tumor protein p53 inducible nuclear protein 1 | 10116 | RGD:631423 | OMA, EggNOG |
| Dog | 611710 | TP53INP1 | tumor protein p53 inducible nuclear protein 1 | 9615 | VGNC:47725 | Inparanoid, OMA, EggNOG |
| Horse | 100055346 | TP53INP1 | tumor protein p53 inducible nuclear protein 1 | 9796 | VGNC:24423 | Inparanoid, OMA, EggNOG |
| Cow | 782667 | TP53INP1 | tumor protein p53 inducible nuclear protein 1 | 9913 | VGNC:36236 | Inparanoid, OMA, EggNOG |
| Opossum | 100022681 | TP53INP1 | tumor protein p53 inducible nuclear protein 1 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100081400 | TP53INP1 | tumor protein p53 inducible nuclear protein 1 | 9258 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100563989 | tp53inp1 | tumor protein p53 inducible nuclear protein 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100490057 | tp53inp1 | tumor protein p53 inducible nuclear protein 1 | 8364 | XB-GENE-959922 | Inparanoid, OMA, EggNOG |
| Zebrafish | 568021 | tp53inp1 | tumor protein p53 inducible nuclear protein 1 | 7955 | ZDB-GENE-031018-3 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.