🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

ELK1

DescripciónETS domain-containing protein Elk-1

Gene and Protein Information

Gene ID2002
Uniprot Accession IDs P19419 B2R7H4 O75606 O95058 Q969X8 Q9UJM4
Ensembl ID ENSP00000483056
FamilyBelongs to the ETS family.
Sequence
MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKLSRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSTMPNVAPAAIHAAPGDTVSGKPGTPKGAGMAGPGGLARSSRNEYMRSGLYSTFTIQSLQPQPPPHPRPAVVLPSAAPAGAAAPPSGSRSTSPSPLEACLEAEEAGLPLQVILTPPEAPNLKSEELNVEPGLGRALPPEVKVEGPKEELEVAGERGFVPETTKAEPEVPPQEGVPARLPAVVMDTAGQAGGHAASSPEISQPQKGRKPRDLELPLSPSLLGGPGPERTPGSGSGSGLQAPGPALTPSLLPTHTLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPVVLSPGPQKP
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp473591ELK1ELK1, ETS transcription factor9598VGNC:12308OMA, EggNOG
Mouse13712Elk1ELK1, member of ETS oncogene family10090MGI:101833Inparanoid, OMA, EggNOG
Rat314436Elk1ELK1, ETS transcription factor10116RGD:1598663Inparanoid, OMA, EggNOG
Dog491860ELK1ELK1, ETS transcription factor9615VGNC:40303Inparanoid, OMA, EggNOG
Horse100051388ELK1ELK1, ETS transcription factor9796VGNC:17523Inparanoid, OMA, EggNOG
Cow786886ELK1ELK1, ETS transcription factor9913VGNC:28432Inparanoid, OMA, EggNOG
Pig100522002ELK1ELK1, ETS transcription factor9823Inparanoid, OMA
OpossumELK1ELK1, ETS transcription factor [Source:HGNC Symbol;Acc:HGNC:3321]13616OMA, EggNOG
Anole lizardELK1ELK1, ETS transcription factor [Source:HGNC Symbol;Acc:HGNC:3321]28377OMA, EggNOG
Xenopus100497609elk1ELK1, member of ETS oncogene family8364XB-GENE-5992134Inparanoid, OMA, EggNOG
Zebrafish567895elk1ELK1, member of ETS oncogene family7955ZDB-GENE-090529-5Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.