224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Elongation of very long chain fatty acids protein 3 |
|---|
Gene and Protein Information
| Gene ID | 83401 |
|---|---|
| Uniprot Accession IDs | Q9HB03 Q5VZL3 Q8N180 |
| Ensembl ID | ENSP00000359022 |
| Symbol | CIG30 CIG30 CIG-30 |
| Family | Belongs to the ELO family. ELOVL3 subfamily. |
| Sequence | MVTAMNVSHEVNQLFQPYNFELSKDMRPFFEEYWATSFPIALIYLVLIAVGQNYMKERKGFNLQGPLILWSFCLAIFSILGAVRMWGIMGTVLLTGGLKQTVCFINFIDNSTVKFWSWVFLLSKVIELGDTAFIILRKRPLIFIHWYHHSTVLVYTSFGYKNKVPAGGWFVTMNFGVHAIMYTYYTLKAANVKPPKMLPMLITSLQILQMFVGAIVSILTYIWRQDQGCHTTMEHLFWSFILYMTYFILFAHFFCQTYIRPKVKAKTKSQ |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 745450 | ELOVL3 | ELOVL fatty acid elongase 3 | 9598 | VGNC:7275 | OMA, EggNOG |
| Macaque | 712927 | ELOVL3 | ELOVL fatty acid elongase 3 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 12686 | Elovl3 | elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 3 | 10090 | MGI:1195976 | Inparanoid, OMA, EggNOG |
| Rat | 309449 | Elovl3 | ELOVL fatty acid elongase 3 | 10116 | RGD:1307263 | Inparanoid, OMA, EggNOG |
| Dog | 486855 | ELOVL3 | ELOVL fatty acid elongase 3 | 9615 | VGNC:40321 | Inparanoid, OMA, EggNOG |
| Horse | 100060081 | ELOVL3 | ELOVL fatty acid elongase 3 | 9796 | VGNC:17539 | Inparanoid, OMA, EggNOG |
| Cow | 539782 | ELOVL3 | ELOVL fatty acid elongase 3 | 9913 | VGNC:28449 | Inparanoid, OMA, EggNOG |
| Pig | 100155434 | ELOVL3 | ELOVL fatty acid elongase 3 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100029282 | ELOVL3 | ELOVL fatty acid elongase 3 | 13616 | Inparanoid, EggNOG | |
| Platypus | 100080155 | ELOVL3 | ELOVL fatty acid elongase 3 | 9258 | Inparanoid, OMA, EggNOG | |
| C. elegans | 183948 | elo-3 | Putative fatty acid elongation protein 3 | 6239 | Inparanoid, OMA | |
| S.cerevisiae | 853243 | ELO1 | fatty acid elongase ELO1 | 4932 | S000003732 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / transferase / acyltransferase / Elongation of very long chain fatty acids protein 3
protein / transferase / acyltransferase / Elongation of very long chain fatty acids protein 3
DTO Classes
protein / Enzyme / Transferase / Acyltransferase / Elongation of very long chain fatty acids protein 3
protein / Enzyme / Transferase / Acyltransferase / Elongation of very long chain fatty acids protein 3
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.