🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

TFG

DescripciónProtein TFG

Gene and Protein Information

Gene ID10342
Uniprot Accession IDs Q92734 D3DN49 G5E9V1 K0J5S8 K0J6K2 Q15656 Q969I2
Ensembl ID ENSP00000240851
Symbol TF6 HMSNP SPG57 TRKT3
Sequence
MNGQLDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKDEDGDLITIFDSSDLSFAIQCSRILKLTLFVNGQPRPLESSQVKYLRRELIELRNKVNRLLDSLEPPGEPGPSTNIPENDTVDGREEKSASDSSGKQSTQVMAASMSAFDPLKNQDEINKNVMSAFGLTDDQVSGPPSAPAEDRSGTPDSIASSSSAAHPPGVQPQQPPYTGAQTQAGQIEGQMYQQYQQQAGYGAQQPQAPPQQPQQYGIQYSASYSQQTGPQQPQQFQGYGQQPTSQAPAPAFSGQPQQLPAQPPQQYQASNYPAQTYTAQTSQPTNYTVAPASQPGMAPSQPGAYQPRPGFTSLPGSTMTPPPSGPNPYARNRPPFGQGYTQPGPGYR
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp460557TFGTRK-fused gene9598OMA, EggNOG
Macaque700972TFGTRK-fused gene9544Inparanoid, OMA, EggNOG
Mouse21787TfgTrk-fused gene10090MGI:1338041Inparanoid, OMA, EggNOG
Rat360709TfgTrk-fused gene10116RGD:1309751Inparanoid, OMA, EggNOG
Dog487954TFGTRK-fused gene9615VGNC:47299Inparanoid, OMA, EggNOG
Horse100072249TFGTRK-fused gene9796VGNC:24044Inparanoid, OMA, EggNOG
Cow505171TFGTRK-fused gene9913Inparanoid, OMA
Pig414406TFGTRK-fused gene9823Inparanoid, OMA, EggNOG
Opossum100013086TFGTRK-fused gene13616OMA, EggNOG
Platypus100089084TFGTRK-fused gene9258Inparanoid, OMA, EggNOG
Chicken418391TFGTRK-fused gene9031CGNC:11390Inparanoid, OMA, EggNOG
Anole lizard100561691tfgTRK-fused gene28377Inparanoid, OMA, EggNOG
Xenopus493334tfgtrk-fused gene8364XB-GENE-960556Inparanoid, OMA, EggNOG
Zebrafish336466tfgtrk-fused gene7955ZDB-GENE-030131-8410Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreEspecificacionesSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.