TBCA

DescripciónTubulin-specific chaperone A

Gene and Protein Information

Gene ID6902
Uniprot Accession IDs O75347 B4DT30
Ensembl ID ENSP00000306362
FamilyBelongs to the TBCA family.
Sequence
MADPRVRQIKIKTGVVKRLVKEKVMYEKEAKQQEEKIEKMRAEDGENYDIKKQAEILQESRMMIPDCQRRLEAAYLDLQRILENEKDLEEAEEYKEARLVLDSVKLEA
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp737862TBCAtubulin folding cofactor A9598VGNC:4189OMA, EggNOG
Mouse21371Tbcatubulin cofactor A10090MGI:107549Inparanoid, OMA, EggNOG
Rat366995Tbcatubulin folding cofactor A10116RGD:1311538Inparanoid, OMA
Dog479173TBCAtubulin folding cofactor A9615VGNC:53246Inparanoid, OMA, EggNOG
HorseTBCAtubulin folding cofactor A [Source:HGNC Symbol;Acc:HGNC:11579]9796OMA, EggNOG
Cow327683TBCAtubulin folding cofactor A9913VGNC:35648Inparanoid, OMA, EggNOG
Pig100523593TBCAtubulin folding cofactor A9823OMA, EggNOG
Opossum100032660TBCAtubulin folding cofactor A13616Inparanoid, OMA, EggNOG
Platypus100083575TBCAtubulin folding cofactor A9258Inparanoid, OMA, EggNOG
Chicken416367TBCAtubulin folding cofactor A9031CGNC:3204Inparanoid, OMA, EggNOG
Anole lizard100559239tbcatubulin folding cofactor A28377OMA, EggNOG
Xenopus100038159tbcatubulin folding cofactor A8364XB-GENE-490490Inparanoid, OMA, EggNOG
Zebrafish394029tbcatubulin cofactor a7955ZDB-GENE-040426-962Inparanoid, OMA, EggNOG
C. elegans171791tbca-1Tubulin-specific chaperone A6239OMA, EggNOG
Fruitfly43737CG1890CG1890 gene product from transcript CG1890-RA7227FBgn0039869Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein    /    chaperone    /    chaperonin    /    Tubulin-specific chaperone A
DTO Classes
protein    /    Chaperone    /    Chaperonin    /    Tubulin-specific chaperone A

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.