Alternar navegación 
Buscar
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock
| Descripción | Mitochondrial import receptor subunit TOM22 homolog |
|---|
Gene and Protein Information
| Gene ID | 56993 |
|---|---|
| Uniprot Accession IDs | Q9NS69 hTom22 |
| Ensembl ID | ENSP00000216034 |
| Symbol | TOM22 1C9-2 TOM22 MST065 MSTP065 |
| Family | Belongs to the Tom22 family. |
| Sequence | MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPGKI |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 743431 | TOMM22 | translocase of outer mitochondrial membrane 22 | 9598 | VGNC:8866 | OMA, EggNOG |
| Macaque | 701286 | TOMM22 | translocase of outer mitochondrial membrane 22 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 223696 | Tomm22 | translocase of outer mitochondrial membrane 22 | 10090 | MGI:2450248 | Inparanoid, OMA, EggNOG |
| Rat | 300075 | Tomm22 | translocase of outer mitochondrial membrane 22 | 10116 | RGD:1303260 | Inparanoid, OMA, EggNOG |
| Dog | 610117 | TOMM22 | translocase of outer mitochondrial membrane 22 | 9615 | Inparanoid, OMA | |
| Dog | 100855486 | LOC100855486 | mitochondrial import receptor subunit TOM22 homolog | 9615 | OMA, EggNOG | |
| Horse | 100070131 | TOMM22 | translocase of outer mitochondrial membrane 22 | 9796 | VGNC:49131 | Inparanoid, OMA, EggNOG |
| Cow | 510780 | TOMM22 | translocase of outer mitochondrial membrane 22 | 9913 | VGNC:49064 | Inparanoid, OMA, EggNOG |
| Pig | 100520786 | TOMM22 | translocase of outer mitochondrial membrane 22 | 9823 | OMA, EggNOG | |
| Opossum | 100013414 | TOMM22 | translocase of outer mitochondrial membrane 22 | 13616 | OMA, EggNOG | |
| Platypus | TOMM22 | translocase of outer mitochondrial membrane 22 [Source:HGNC Symbol;Acc:HGNC:18002] | 9258 | OMA, EggNOG | ||
| Chicken | 770933 | TOMM22 | translocase of outer mitochondrial membrane 22 | 9031 | CGNC:13830 | Inparanoid, EggNOG |
| Anole lizard | 100563605 | tomm22 | translocase of outer mitochondrial membrane 22 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 734118 | tomm22 | translocase of outer mitochondrial membrane 22 homolog | 8364 | XB-GENE-951173 | Inparanoid, OMA, EggNOG |
| Zebrafish | 321232 | tomm22 | translocase of outer mitochondrial membrane 22 homolog (yeast) | 7955 | ZDB-GENE-030131-9810 | Inparanoid, OMA, EggNOG |
| C. elegans | 173436 | tomm-22 | Mitochondrial import receptor subunit TOM22 homolog | 6239 | Inparanoid, OMA | |
| Fruitfly | 38459 | mge | maggie | 7227 | FBgn0035473 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Especificaciones | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Recordármelo más tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.