THY1

DescripciónThy-1 membrane glycoprotein

Gene and Protein Information

Gene ID7070
Uniprot Accession IDs P04216 Q16008 Q9NSP1
Ensembl ID ENSP00000284240
Symbol CD90 CDw90
Sequence
MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNTSWLLLLLLSLSLLQATDFMSL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp451611THY1Thy-1 cell surface antigen9598VGNC:8275OMA, EggNOG
Macaque705321THY1Thy-1 cell surface antigen9544Inparanoid, OMA
Mouse21838Thy1thymus cell antigen 1, theta10090MGI:98747Inparanoid, OMA, EggNOG
Rat24832Thy1Thy-1 cell surface antigen10116RGD:3860Inparanoid, OMA, EggNOG
Dog489365THY1Thy-1 cell surface antigen9615VGNC:47362Inparanoid, OMA, EggNOG
Horse100063377THY1Thy-1 cell surface antigen9796VGNC:24097Inparanoid, OMA, EggNOG
Cow614712THY1Thy-1 cell surface antigen9913VGNC:35856Inparanoid, OMA, EggNOG
Opossum100031120THY1Thy-1 cell surface antigen13616Inparanoid, OMA, EggNOG
Chicken378897THY1Thy-1 cell surface antigen9031CGNC:5094Inparanoid, OMA
Xenopus100101744thy1Thy-1 cell surface antigen8364XB-GENE-493820Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.