EXOSC2

DescripciónExosome complex component RRP4

Gene and Protein Information

Gene ID23404
Uniprot Accession IDs Q13868 A3KFL3 A3KFL4 B4DKK6 Q9NUY4
Ensembl ID ENSP00000361433
Symbol RRP4 p7 RRP4 SHRF Rrp4p hRrp4p
FamilyBelongs to the RRP4 family.
Sequence
MAMEMRLPVARKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSVERVNKLICVKALKTRYIGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNLPGGELRRRSAEDELAMRGFLQEGDLISAEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQKTHFHDLPCGASVILGNNGFIWIYPTPEHKEEEAGGFIANLEPVSLADREVISRLRNCIISLVTQRMMLYDTSILYCYEASLPHQIKDILKPEIMEEIVMETRQRLLEQEG
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp107976800EXOSC2exosome component 29598VGNC:4686OMA, EggNOG
Macaque715960EXOSC2exosome component 29544Inparanoid, OMA, EggNOG
Mouse227715Exosc2exosome component 210090MGI:2385133Inparanoid, OMA, EggNOG
Rat366017Exosc2exosome component 210116RGD:1306573Inparanoid, OMA, EggNOG
Dog608606EXOSC2exosome component 29615VGNC:40523Inparanoid, OMA, EggNOG
Horse100069734EXOSC2exosome component 29796VGNC:17732Inparanoid, OMA, EggNOG
Cow615712EXOSC2exosome component 29913VGNC:28657Inparanoid, OMA, EggNOG
Pig100523112EXOSC2exosome component 29823OMA, EggNOG
Opossum100619468EXOSC2exosome component 213616Inparanoid, EggNOG
Platypus100075716EXOSC2exosome component 29258Inparanoid, OMA, EggNOG
Anole lizard100562463exosc2exosome component 228377Inparanoid, OMA, EggNOG
Xenopus595050exosc2exosome component 28364XB-GENE-977773Inparanoid, OMA, EggNOG
Zebrafish550234exosc2exosome component 27955ZDB-GENE-050417-27Inparanoid, OMA, EggNOG
C. elegans177403exos-2EXOSome (multiexonuclease complex) component6239Inparanoid, OMA, EggNOG
Fruitfly37731Rrp4CG3931 gene product from transcript CG3931-RA7227FBgn0034879Inparanoid, EggNOG
S.cerevisiae856466RRP4exosome non-catalytic core subunit RRP44932S000001111Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein    /    hydrolase    /    esterase    /    Exosome complex component RRP4
protein    /    hydrolase    /    RNA binding protein    /    Exosome complex component RRP4
protein    /    hydrolase    /    nuclease    /    Exosome complex component RRP4
protein    /    hydrolase    /    exoribonuclease    /    Exosome complex component RRP4
DTO Classes
protein    /    Enzyme    /    Nuclease    /    Exoribonuclease    /    Exosome complex component RRP4

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.