🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

CD84

DescripciónSLAM family member 5

Gene and Protein Information

Gene ID8832
Uniprot Accession IDs Q9UIB8 B2R8T1 B7Z3R8 O15430 O95266 O95660 Q5H9R1 Q6FHA8 Q8WLP1 Q8WWI8 Q9UF04 Q9UIB6 Q9UIB7 Q9UIT7
Ensembl ID ENSP00000312367
Symbol SLAMF5 LY9B hCD84 mCD84 SLAMF5
Sequence
MAQHHLWILLLCLQTWPEAAGKDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQLCADIAMGFRTHHTGLLSVLAMFFLLVLILSSVFLFRLFKRRQGRIFPEGSCLNTFTKNPYAASKKTIYTYIMASRNTQPAESRIYDEILQSKVLPSKEEPVNTVYSEVQFADKMGKASTQDSKPPGTSSYEIVI
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Macaque719738CD84CD84 molecule9544Inparanoid, OMA, EggNOG
Mouse12523Cd84CD84 antigen10090MGI:1336885Inparanoid, OMA, EggNOG
Rat501872Cd84CD84 molecule10116RGD:1564553Inparanoid, OMA
Dog488641CD84CD84 molecule9615VGNC:38978Inparanoid, OMA, EggNOG
Horse100058754CD84CD84 molecule9796VGNC:50819Inparanoid, OMA, EggNOG
Cow510910CD84CD84 molecule9913VGNC:53854OMA, EggNOG
Pig100152851CD84CD84 molecule9823OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.