🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

SCGN

DescripciónSecretagogin

Gene and Protein Information

Gene ID10590
Uniprot Accession IDs O76038 A8K0B2 Q5VV44 Q96QV7 Q9UJF6
Ensembl ID ENSP00000367197
Symbol SECRET SEGN CALBL SECRET setagin DJ501N12.8
Sequence
MDSSREPTLGRLDAAGFWQVWQRFDADEKGYIEEKELDAFFLHMLMKLGTDDTVMKANLHKVKQQFMTTQDASKDGRIRMKELAGMFLSEDENFLLLFRRENPLDSSVEFMQIWRKYDADSSGFISAAELRNFLRDLFLHHKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILALQENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp462485SCGNsecretagogin, EF-hand calcium binding protein9598VGNC:3695OMA, EggNOG
Macaque694072SCGNsecretagogin, EF-hand calcium binding protein9544Inparanoid, OMA
Mouse214189Scgnsecretagogin, EF-hand calcium binding protein10090MGI:2384873Inparanoid, OMA, EggNOG
Rat306942Scgnsecretagogin, EF-hand calcium binding protein10116RGD:1303281Inparanoid, OMA, EggNOG
Dog610954SCGNsecretagogin, EF-hand calcium binding protein9615VGNC:45909Inparanoid, OMA, EggNOG
Horse100067986SCGNsecretagogin, EF-hand calcium binding protein9796VGNC:22725Inparanoid, OMA, EggNOG
Cow618206SCGNsecretagogin, EF-hand calcium binding protein9913VGNC:34337Inparanoid, OMA, EggNOG
Pig768111SCGNsecretagogin, EF-hand calcium binding protein9823Inparanoid, OMA, EggNOG
OpossumSCGNsecretagogin, EF-hand calcium binding protein [Source:HGNC Symbol;Acc:HGNC:16941]13616Inparanoid, OMA, EggNOG
Platypus100087054SCGNsecretagogin, EF-hand calcium binding protein9258Inparanoid, OMA, EggNOG
Chicken421001SCGNsecretagogin, EF-hand calcium binding protein9031CGNC:10196Inparanoid, OMA, EggNOG
Anole lizard100566868scgnsecretagogin, EF-hand calcium binding protein28377Inparanoid, OMA, EggNOG
Xenopus780242scgnsecretagogin, EF-hand calcium binding protein8364XB-GENE-988344Inparanoid, OMA, EggNOG
Zebrafish573010scgnsecretagogin, EF-hand calcium binding protein7955ZDB-GENE-041010-82Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.