224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Sigma non-opioid intracellular receptor 1 |
|---|
Gene and Protein Information
| Gene ID | 10280 |
|---|---|
| Uniprot Accession IDs | Q99720 D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0 |
| Ensembl ID | ENSP00000277010 |
| Symbol | OPRS1 SRBP SRBP ALS16 DSMA2 OPRS1 SR-BP SIG-1R SR-BP1 sigma1R hSigmaR1 |
| Family | Belongs to the ERG2 family. |
| Sequence | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 465062 | SIGMAR1 | sigma non-opioid intracellular receptor 1 | 9598 | VGNC:10120 | OMA, EggNOG |
| Macaque | 700469 | SIGMAR1 | sigma non-opioid intracellular receptor 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 18391 | Sigmar1 | sigma non-opioid intracellular receptor 1 | 10090 | MGI:1195268 | Inparanoid, OMA, EggNOG |
| Rat | 29336 | Sigmar1 | sigma non-opioid intracellular receptor 1 | 10116 | RGD:68364 | Inparanoid, OMA, EggNOG |
| Dog | 481587 | SIGMAR1 | sigma non-opioid intracellular receptor 1 | 9615 | VGNC:46170 | Inparanoid, OMA, EggNOG |
| Horse | SIGMAR1 | sigma non-opioid intracellular receptor 1 [Source:HGNC Symbol;Acc:HGNC:8157] | 9796 | OMA, EggNOG | ||
| Cow | 538903 | SIGMAR1 | sigma non-opioid intracellular receptor 1 | 9913 | VGNC:34619 | Inparanoid, OMA, EggNOG |
| Opossum | 100028812 | SIGMAR1 | sigma non-opioid intracellular receptor 1 | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 100859748 | SIGMAR1 | sigma non-opioid intracellular receptor 1 | 9031 | CGNC:63401 | Inparanoid, OMA |
| Anole lizard | 100551557 | sigmar1 | sigma non-opioid intracellular receptor 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Zebrafish | 393952 | sigmar1 | sigma non-opioid intracellular receptor 1 | 7955 | ZDB-GENE-040426-1006 | Inparanoid, OMA, EggNOG |
| S.cerevisiae | 855242 | ERG2 | C-8 sterol isomerase ERG2 | 4932 | S000004815 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.