🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

SUGT1

DescripciónProtein SGT1 homolog

Gene and Protein Information

Gene ID10910
Uniprot Accession IDs Q9Y2Z0 A2A303 Q5JAK5 Q5TAM6 Q6VXY6
Ensembl ID ENSP00000367208
Symbol SGT1
FamilyBelongs to the SGT1 family.
Sequence
MAAAAAGTATSQRFFQSFSDALIDEDPQAALEELTKALEQKPDDAQYYCQRAYCHILLGNYCVAVADAKKSLELNPNNSTAMLRKGICEYHEKNYAAALETFTEGQKLDIETGFHRVGQAGLQLLTSSDPPALDSQSAGITGADANFSVWIKRCQEAQNGSESEVWTHQSKIKYDWYQTESQVVITLMIKNVQKNDVNVEFSEKELSALVKLPSGEDYNLKLELLHPIIPEQSTFKVLSTKIEIKLKKPEAVRWEKLEGQGDVPTPKQFVADVKNLYPSSSPYTRNWDKLVGEIKEEEKNEKLEGDAALNRLFQQIYSDGSDEVKRAMNKSFMESGGTVLSTNWSDVGKRKVEINPPDDMEWKKY
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp452744SUGT1SGT1 homolog, MIS12 kinetochore complex assembly cochaperone9598VGNC:7304Inparanoid, OMA, EggNOG
Macaque694046SUGT1SGT1 homolog, MIS12 kinetochore complex assembly cochaperone9544Inparanoid, OMA, EggNOG
Mouse67955Sugt1SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae)10090MGI:1915205Inparanoid, OMA, EggNOG
Rat290408Sugt1SGT1 homolog, MIS12 kinetochore complex assembly cochaperone10116RGD:1307550Inparanoid, OMA, EggNOG
Horse100051549SUGT1SGT1 homolog, MIS12 kinetochore complex assembly cochaperone9796VGNC:23752Inparanoid, OMA, EggNOG
Cow515509SUGT1SGT1 homolog, MIS12 kinetochore complex assembly cochaperone9913VGNC:35465Inparanoid, OMA, EggNOG
Chicken418827SUGT1SGT1 homolog, MIS12 kinetochore complex assembly cochaperone9031CGNC:12721Inparanoid, OMA, EggNOG
Anole lizard100552516sugt1SGT1 homolog, MIS12 kinetochore complex assembly cochaperone28377Inparanoid, OMA, EggNOG
Xenopus548910sugt1SGT1 homolog, MIS12 kinetochore complex assembly cochaperone8364XB-GENE-919559Inparanoid, OMA, EggNOG
Fruitfly40982Sgt1suppressor-of-G2-allele-of-skp17227FBgn0265101Inparanoid, EggNOG
S.cerevisiae854222SGT1co-chaperone SGT14932S000005583Inparanoid, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.