🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

TSNAX

DescripciónTranslin-associated protein X

Gene and Protein Information

Gene ID7257
Uniprot Accession IDs Q99598 B1APC6
Ensembl ID ENSP00000355599
Symbol TRAX C3PO TRAX
FamilyBelongs to the translin family.
Sequence
MSNKEGSGGFRKRKHDNFPHNQRREGKDVNSSSPVMLAFKSFQQELDARHDKYERLVKLSRDITVESKRTIFLLHRITSAPDMEDILTESEIKLDGVRQKIFQVAQELSGEDMHQFHRAITTGLQEYVEAVSFQHFIKTRSLISMDEINKQLIFTTEDNGKENKTPSSDAQDKQFGTWRLRVTPVDYLLGVADLTGELMRMCINSVGNGDIDTPFEVSQFLRQVYDGFSFIGNTGPYEVSKKLYTLKQSLAKVENACYALKVRGSEIPKHMLADVFSVKTEMIDQEEGIS
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp457819TSNAXtranslin associated factor X9598VGNC:10919OMA, EggNOG
Macaque713347TSNAXtranslin associated factor X9544Inparanoid, OMA, EggNOG
Mouse53424Tsnaxtranslin-associated factor X10090MGI:1855672Inparanoid, OMA, EggNOG
Rat64028Tsnaxtranslin-associated factor X10116RGD:621574Inparanoid, OMA, EggNOG
Dog479203TSNAXtranslin associated factor X9615Inparanoid, OMA, EggNOG
Horse100060520TSNAXtranslin associated factor X9796VGNC:51812Inparanoid, OMA, EggNOG
Cow533927TSNAXtranslin associated factor X9913Inparanoid, OMA, EggNOG
Pig100156036TSNAXtranslin associated factor X9823Inparanoid, OMA, EggNOG
Opossum100021903TSNAXtranslin associated factor X13616Inparanoid, OMA, EggNOG
Anole lizard100566407tsnaxtranslin associated factor X28377Inparanoid, OMA, EggNOG
Xenopus448467tsnaxtranslin-associated factor X8364XB-GENE-947707Inparanoid, OMA, EggNOG
Zebrafish556657tsnaxtranslin-associated factor X7955ZDB-GENE-050913-80Inparanoid, OMA
Fruitfly41871TraxTranslin associated factor X7227FBgn0038327Inparanoid, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreEspecificacionesSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.