🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

TAX1BP3

DescripciónTax1-binding protein 3

Gene and Protein Information

Gene ID30851
Uniprot Accession IDs O14907 B2RD53 D3DTJ6 Q7LCQ4
Ensembl ID ENSP00000225525
Symbol TIP1 TIP1 TIP-1
Sequence
MSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp454432TAX1BP3Tax1 binding protein 39598VGNC:12717OMA, EggNOG
Macaque706829TAX1BP3Tax1 binding protein 39544Inparanoid, OMA, EggNOG
Mouse76281Tax1bp3Tax1 (human T cell leukemia virus type I) binding protein 310090MGI:1923531Inparanoid, OMA, EggNOG
Rat360564Tax1bp3Tax1 binding protein 310116RGD:1308924Inparanoid, OMA
Dog100856105TAX1BP3Tax1 binding protein 39615VGNC:47126Inparanoid, OMA, EggNOG
Horse100060592TAX1BP3Tax1 binding protein 39796VGNC:23891Inparanoid, OMA, EggNOG
Cow514852TAX1BP3Tax1 binding protein 39913VGNC:35620Inparanoid, OMA, EggNOG
Pig100515576TAX1BP3Tax1 binding protein 39823OMA, EggNOG
Platypus100077738TAX1BP3Tax1 binding protein 39258Inparanoid, OMA, EggNOG
Chicken417605TAX1BP3Tax1 binding protein 39031CGNC:3415Inparanoid, OMA, EggNOG
Xenopus394838tax1bp3Tax1 binding protein 38364XB-GENE-483851Inparanoid, OMA, EggNOG
Zebrafish406779tax1bp3Tax1 (human T-cell leukemia virus type I) binding protein 37955ZDB-GENE-040426-2830Inparanoid, OMA, EggNOG
C. elegans175685C45G9.7hypothetical protein6239Inparanoid, OMA, EggNOG
Fruitfly38077CG3402CG3402 gene product from transcript CG3402-RA7227FBgn0035148Inparanoid, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.