224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Calcium-independent phospholipase A2-gamma |
|---|
Gene and Protein Information
| Gene ID | 50640 |
|---|---|
| Uniprot Accession IDs | Q9NP80 A4D0S1 C9JZI4 O95035 Q8N3I3 Q9H7T5 Q9NR17 Q9NUN2 Q9NZ79 |
| Ensembl ID | ENSP00000410804 |
| Symbol | IPLA22 IPLA2G MMLA IPLA2G IPLA2-2 iPLA2gamma PNPLA-gamma |
| Sequence | MSINLTVDIYIYLLSNARSVCGKQRSKQLYFLFSPKHYWRISHISLQRGFHTNIIRCKWTKSEAHSCSKHCYSPSNHGLHIGILKLSTSAPKGLTKVNICMSRIKSTLNSVSKAVFGNQNEMISRLAQFKPSSQILRKVSDSGWLKQKNIKQAIKSLKKYSDKSAEKSPFPEEKSHIIDKEEDIGKRSLFHYTSSITTKFGDSFYFLSNHINSYFKRKEKMSQQKENEHFRDKSELEDKKVEEGKLRSPDPGILAYKPGSESVHTVDKPTSPSAIPDVLQVSTKQSIANFLSRPTEGVQALVGGYIGGLVPKLKYDSKSQSEEQEEPAKTDQAVSKDRNAEEKKRLSLQREKIIARVSIDNRTRALVQALRRTTDPKLCITRVEELTFHLLEFPEGKGVAVKERIIPYLLRLRQIKDETLQAAVREILALIGYVDPVKGRGIRILSIDGGGTRGVVALQTLRKLVELTQKPVHQLFDYICGVSTGAILAFMLGLFHMPLDECEELYRKLGSDVFSQNVIVGTVKMSWSHAFYDSQTWENILKDRMGSALMIETARNPTCPKVAAVSTIVNRGITPKAFVFRNYGHFPGINSHYLGGCQYKMWQAIRASSAAPGYFAEYALGNDLHQDGGLLLNNPSALAMHECKCLWPDVPLECIVSLGTGRYESDVRNTVTYTSLKTKLSNVINSATDTEEVHIMLDGLLPPDTYFRFNPVMCENIPLDESRNEKLDQLQLEGLKYIERNEQKMKKVAKILSQEKTTLQKINDWIKLKTDMYEGLPFFSKL Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 472484 | PNPLA8 | patatin like phospholipase domain containing 8 | 9598 | VGNC:4472 | OMA, EggNOG |
| Macaque | 700851 | PNPLA8 | patatin like phospholipase domain containing 8 | 9544 | Inparanoid, OMA | |
| Mouse | 67452 | Pnpla8 | patatin-like phospholipase domain containing 8 | 10090 | MGI:1914702 | Inparanoid, OMA, EggNOG |
| Rat | 314075 | Pnpla8 | patatin-like phospholipase domain containing 8 | 10116 | RGD:1311444 | Inparanoid, OMA, EggNOG |
| Dog | 475880 | PNPLA8 | patatin like phospholipase domain containing 8 | 9615 | VGNC:44758 | Inparanoid, OMA, EggNOG |
| Horse | 100060568 | PNPLA8 | patatin like phospholipase domain containing 8 | 9796 | VGNC:21638 | Inparanoid, OMA, EggNOG |
| Cow | 535496 | PNPLA8 | patatin like phospholipase domain containing 8 | 9913 | VGNC:33095 | Inparanoid, OMA, EggNOG |
| Opossum | 100010579 | PNPLA8 | patatin like phospholipase domain containing 8 | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 417785 | PNPLA8 | patatin like phospholipase domain containing 8 | 9031 | CGNC:7233 | OMA, EggNOG |
| Anole lizard | 100558210 | pnpla8 | patatin like phospholipase domain containing 8 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100038186 | pnpla8 | patatin like phospholipase domain containing 8 | 8364 | XB-GENE-495321 | Inparanoid, OMA, EggNOG |
| Zebrafish | 100126812 | pnpla8 | patatin-like phospholipase domain containing 8 | 7955 | ZDB-GENE-070705-553 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.