PCGF1

DescripciónPolycomb group RING finger protein 1

Gene and Protein Information

Gene ID84759
Uniprot Accession IDs Q9BSM1 Q7Z506
Ensembl ID ENSP00000233630
Symbol NSPC1 RNF68 NSPC1 RNF68 RNF3A-2 2010002K04Rik
Sequence
MASPQGGQIAIAMRLRNQLQSVYKMDPLRNEEEVRVKIKDLNEHIVCCLCAGYFVDATTITECLHTFCKSCIVKYLQTSKYCPMCNIKIHETQPLLNLKLDRVMQDIVYKLVPGLQDSEEKRIREFYQSRGLDRVTQPTGEEPALSNLGLPFSSFDHSKAHYYRYDEQLNLCLERLSSGKDKNKSVLQNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQIWLSRWFGKPSPLLLQYSVKEKRR
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp459338PCGF1polycomb group ring finger 19598VGNC:331OMA, EggNOG
Macaque715341PCGF1polycomb group ring finger 19544OMA, EggNOG
Mouse69837Pcgf1polycomb group ring finger 110090MGI:1917087Inparanoid, OMA, EggNOG
Rat312480Pcgf1polycomb group ring finger 110116RGD:1549782Inparanoid, EggNOG
Dog475785PCGF1polycomb group ring finger 19615VGNC:44300Inparanoid, OMA, EggNOG
Horse100053783PCGF1polycomb group ring finger 19796VGNC:21197Inparanoid, OMA, EggNOG
Cow539040PCGF1polycomb group ring finger 19913VGNC:32626Inparanoid, OMA, EggNOG
Opossum100017124PCGF1polycomb group ring finger 113616Inparanoid, OMA, EggNOG
Anole lizard100566980pcgf1polycomb group ring finger 128377Inparanoid, OMA, EggNOG
Zebrafish368900pcgf1polycomb group ring finger 17955ZDB-GENE-030616-605Inparanoid, OMA

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.