The store will not work correctly when cookies are disabled.
JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.
· · COA & SDS 모든 제품에 대한 사용 가능 · 주식 상품에 대한 같은 날 배송 Cagrilintide acetate - ≥98% , CAS No.1415456-99-3(free base)
Storage
Protected from light,Store at -20°C,Argon charged,Desiccated
Shipped In
Ice chest + Ice pads
🧪
이 등급을 선택하는 이유 ≥98% 최소한의 기준선 간섭이 필요한 민감한 크로마토그래피 및 분석 워크플로우용.
🌡
보관 및 배송 Protected from light,Store at -20°C,Argon charged,Desiccated Ice chest + Ice pads 출고. 정확한 사양은 로트별 COA를 확인하세요.
📋
품질 문서 SDS, COA, 데이터시트, 사양서를 다운로드할 수 있습니다. 로트별 COA는 로트 번호 조회를 통해 확인할 수 있습니다.
📚
문헌적 근거 크로마토그래피, 유기 합성 및 교차 커플링 반응 분야의 동료 심사 논문 0편에서 인용되었습니다.
개요 Sequence:{Eicosanedioic acid-γ-Glu}-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Glu-Phe-Leu-Arg-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Pro-NH2 (Disulfide bridge:Cys3-Cys8)
Sequence Shortening:{Eicosanedioic acid-γ-Glu}-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2 (Disulfide bridge:Cys3-Cys8)
Cagrilintide is a long-acting amylin analogue acting as a dual agonist of the amylin receptor and calcitonin receptor, reducing body weight and food intake for obesity research.
사양 보관 조건
Protected from light,Store at -20°C,Argon charged,Desiccated
배송
Ice chest + Ice pads
이 제품은 콜드 체인 배송이 필요합니다.지상 및 기타 경제 서비스는 사용할 수 없습니다.
이름과 식별자
문서 📋 안전 데이터 시트(SDS) 위험성, 취급, 보관 및 규제 준수를 포괄하는 종합 문서.
<<<<<<< HEAD
SDS 다운로드 → =======
SDS 다운로드 → >>>>>>> release248-p3
✅ 분석 성적서(COA) 로트별 품질 데이터. 로트 번호를 입력하여 정확한 COA를 확인하세요.
COA 조회 →
고급 데이터 인증서(CoA, COO, BSE/TSE 및 분석 차트) 화학 및 물리적 특성 용해성 H2O : 100 mg/mL (22.38 mM; ultrasonic and warming and heat to 60°C) 감도 Light sensitive；Moisture sensitive
자주 묻는 질문과 기사 솔루션 계산기 Molarity Calculator Determine the necessary mass, volume, or concentration for preparing a solution.
Dilution Calculator Determine the dilution needed to prepare a stock solution.
Reconstitution Calculator 리뷰
당사는 웹사이트가 올바르게 작동하도록 하고, 허용되는 경우 귀하의 경험을 개선하기 위해 쿠키를 사용합니다. 설정에서 언제든지 환경설정을 관리하실 수 있습니다. 자세한 내용은
쿠키 정책 을 참조하십시오.
설정 모두 동의 Decline
Shall we send you a message when we have discounts available?
Remind me later Allow
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.
H2619222
