Determine the necessary mass, volume, or concentration for preparing a solution.
Why this grade
≥95% for sensitive chromatographic and analytical workflows requiring minimal baseline interference.
Storage & shipping
Store at -20°C,Desiccated Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.
Quality documents
SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.
Literature proof
Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.
Specifications
Product Name
PACAP 6-38 TFA, CAS No.143748-18-9(free base)
사양 및 순도
≥95%
생화학 및 생리적 메커니즘
Potent and competitive pituitary adenylate cyclase-activating polypeptide receptor (PAC)1antagonist (IC50= 2 nM). Inhibits PACAP(1-27)-induced stimulation of adenylate cyclase (Ki= 1.5 nM). Antitumor activityin vivo.
시퀀스
FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK(Modifications: Lys-33 = C-terminal amide)
CAS
143748-18-9(free base)
분자 유형
Peptide
보관 및 배송
보관 조건
Store at -20°C,Desiccated
배송
Ice chest + Ice pads
Documentation
📋 Safety Data Sheet (SDS)
Comprehensive hazard, handling, storage, and regulatory compliance document.
Download SDS →✅ Certificate of Analysis (COA)
Lot-specific quality data. Enter your lot number to retrieve the exact COA.
Look up COA →🔬 Specification Sheet
Full quality attributes and acceptance criteria for this grade.
View spec sheet →Advanced Data
인증서(CoA, COO, BSE/TSE 및 분석 차트)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | 날짜 | 항목 |
|---|---|---|---|
 A2422434 | Certificate of Analysis | Dec 19, 2023 | P288450 |
| A2422435 | Certificate of Analysis | Dec 19, 2023 | P288450 |
| A2422436 | Certificate of Analysis | Dec 19, 2023 | P288450 |
| A2422437 | Certificate of Analysis | Dec 19, 2023 | P288450 |
| A2422438 | Certificate of Analysis | Dec 19, 2023 | P288450 |
| A2422439 | Certificate of Analysis | Dec 19, 2023 | P288450 |
| A2422440 | Certificate of Analysis | Dec 19, 2023 | P288450 |
| A2422441 | Certificate of Analysis | Dec 19, 2023 | P288450 |
| A2422442 | Certificate of Analysis | Dec 19, 2023 | P288450 |
| A2422443 | Certificate of Analysis | Dec 19, 2023 | P288450 |
솔루션 계산기
리뷰
고객 리뷰
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.