Recombinant Human CD300c Protein, ≥95% (SDS-PAGE)

Cat. No.: rp143943

등급 & 순도 Animal Free, Carrier Free, Bioactive, ActiBioPure™, Azide Free, High Performance, His Tag, ≥95%(SDS-PAGE)

Accession #

Q08708

Protein Tag

C-His

Expression system

HEK293

Endotoxin Concentration

<0.1 EU/μg

Bioactivity

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated human T cells. Human T lymphocytes cultured for 72 hours with PHA were incubated for an additional 3 days in 96 well plates coated with 500 ng/mL antiCD3 and Recombinant Human CD300c Fc Chimera. The ED50 for this effect is 4-16 μg/mL.

개요

Purity
≥95% (SDS-PAGE)
Endotoxin level
<0.1 EU/μg
Function
Leukocyte mono-Ig-like receptor 2 (LMIR2; also CMRF-35, CMRF35-A antigen, and CD300c antigen) is a 23 kDa (predicted) type I transmembrane glycoprotein that belongs to the immunoregulatory signaling (IRS) family of molecules within the immunoglobulin (Ig) superfamily. Human LMIR2 is synthesized as a 224 amino acid (aa) precursor that has a 20 aa signal sequence, a 163 aa extracellular domain (ECD), a 21 aa transmembrane region, and a 20 aa cytoplasmic tail (SwissProt # Q08708). The ECD contains an Ig-like V-type domain (aa’s 22-128) and two N-linked glycosylation sites (aa’s 90 and 99). Downstream of the Ig V-domain, the membrane proximal region of LMIR2 (aa 128-183) contains a high proportion of proline (18%), serine (20%) and threonine (13%) residues. The transmembrane segment contains a charged glutamic acid that contributes to cell activation. Human LMIR2 shares 52% aa sequence identity with the mouse LMIR2, which is also known as CLM4. Human LMIR2 is 90% identical to human LMIR1 within the Ig-like domain. LMIR2 is present on the surface of natural killer cells, granulocytes, most myeloid cells, dendritic cells, and a subpopulation of T and B lymphocytes.

사양

Product Name

Recombinant Human CD300c Protein, ≥95% (SDS-PAGE)

동의어

CD300 antigen-like family member C | CLM-6 | CMRF-35 | CMRF35-A1 | IgSF16 | Immunoglobulin superfamily member 16 | CD300 antigen-like family member C | CD300c | CD300c antigen | CD300c molecule | CLM-6 | CLM6_HUMAN | CMRF-35 | CMRF-35A | CMRF35 | CMRF35 a

등급

ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance, His Tag

사양 및 순도

Animal Free,Carrier Free,Bioactive,ActiBioPure™,Azide Free,High Performance,His-Tag,≥95%(SDS-PAGE)

순도

≥95% (SDS-PAGE)

생체 활성

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated human T cells. Human T lymphocytes cultured for 72 hours with PHA were incubated for an additional 3 days in 96 well plates coated with 500 ng/mL antiCD3 and Recombinant Human CD300c Fc Chimera. The ED50 for this effect is 4-16 μg/mL.

내독소 농도

<0.1 EU/μg

표현식 시스템

HEK293

종

Human

아미노산

21-183 aa

시퀀스

GYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVRHHHHHH

단백질 태그

C-His

가입 번호

Q08708

예상 분자량

45 kDa

SDS-PAGE

40 - 50 kDa, under reducing conditions; 40 - 50 kDa, under non-reducing conditions.

분자 유형

Protein

Product Line

생물 제품

보관 및 배송

모양

Lyophilized

재구성

Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.

보관 조건

Store at -20°C,Avoid repeated freezing and thawing

배송

Ice chest + Ice pads

안정성 및 스토리지

Store at -20~-80℃ for more than 1 year. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.

이미지

SDS-PAGE: Recombinant Human CD300c Protein (rp143943)

Recombinant Human CD300c Protein (rp143943) - SDS-PAGE
3 μg/lane of Recombinant Human CD300c Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 40 - 50 kDa.

자주 묻는 질문

What is the purity of this product, and how is it determined?

This product is supplied at ≥95% purity, determined by SDS-PAGE. Lot-specific values are stated on the Certificate of Analysis.

What does Animal Free mean?

Animal Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.

What documentation is provided?

Available product documentation, including Certificates of Analysis (COA), Safety Data Sheets (SDS), and specification sheets, is shown in the product document area. Document availability and access follow the current site policy.

What does Carrier Free mean?

Carrier Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.

How should this product be stored?

Store at ?20 °C. Avoid repeated freeze–thaw cycles. Aliquot into single-use volumes before freezing.

How is this product shipped?

This product ships in an insulated container with ice pads. Unpack on arrival and transfer it to the storage condition stated above.