Recombinant Human DBNDD2 Protein

Cat. No.: rp189367

등급 & 순도 Carrier Free, His Tag, ≥95%(SDS-PAGE), See COA

Accession #

Q9BQY9

Protein Tag

N-His

Expression system

E. coli

Endotoxin Concentration

<1.0 EU/μg

사양

Product Name

Recombinant Human DBNDD2 Protein

동의어

C20orf35 | Casein kinase-1 binding protein | CK1BP | DBND2_HUMAN | Dbndd2 | Dysbindin (dystrobrevin binding protein 1) domain containing 2 | Dysbindin domain-containing protein 2 | HSMNP1 | SCF apoptosis response protein 1

등급

Carrier Free, His Tag

사양 및 순도

Carrier Free,His-Tag,≥95%(SDS-PAGE),See COA

생화학 및 생리적 메커니즘

May modulate the activity of casein kinase-1. Inhibits CSNK1D autophosphorylation (in vitro).

내독소 농도

<1.0 EU/μg

아미노산

2-161 aa

시퀀스

MHHHHHHDPNPRAALERQQLRLRERQKFFEDILQPETEFVFPLSHLHLESQRPPIGSISSMEVNVDTLEQVELIDLGDPDAADVFLPCEDPPPTPQSSGMDNHLEELSLPVPTSDRTTSRTSSSSSSDSSTNLHSPNPSDDGADTPLAQSDEEEERGDGGAEPGACS

가입 번호

Q9BQY9

예상 분자량

18.3 kDa

SDS-PAGE

28.5 kDa, under reducing conditions; 26.1 & 28.9 kDa, under non-reducing conditions.

분자 유형

Protein

Product Line

생물 제품

보관 및 배송

집중력

See COA

보관 조건

Store at -20°C,Avoid repeated freezing and thawing

배송

Ice chest + Ice pads

안정성 및 스토리지

Store at -20℃ for 12 months. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.

이미지

SDS-PAGE: Recombinant Human DBNDD2 Protein (rp189367)

Recombinant Human DBNDD2 Protein (rp189367) - SDS-PAGE
3 μg/lane of Recombinant Human DBNDD2 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 28.5 kDa under reducing conditions and 26.1 & 18.9 kDa under non-reducing conditions.
It is speculated that cysteine affects the non-reducing band, causing differences from the reducing band.

자주 묻는 질문

What is the purity of this product, and how is it determined?

This product is supplied at ≥95% purity, determined by SDS-PAGE. Lot-specific values are stated on the Certificate of Analysis.

What does Carrier Free mean?

Carrier Free indicates that the material has been processed and tested for specialty industrial processing. Specifications focus on the impurities that affect performance in that application — for example, metal content for electronics, particle size for batteries, refractive index for optics, or moisture content for moisture-sensitive processes.

What is His Tag?

His Tag refers to a recombinant protein product fused with the His affinity tag, suitable for recombinant protein expression and affinity purification. The tag enables one-step affinity purification, immobilization or detection without affecting downstream activity in most cases.

How should this product be stored?

Store at ?20 °C. Avoid repeated freeze–thaw cycles. Aliquot into single-use volumes before freezing.

What documentation is provided?

Available product documentation, including Certificates of Analysis (COA), Safety Data Sheets (SDS), and specification sheets, is shown in the product document area. Document availability and access follow the current site policy.

How is this product shipped?

This product ships in an insulated container with ice pads. Unpack on arrival and transfer it to the storage condition stated above.