Recombinant Human FGF basic Protein, >95% (SDS-PAGE)

Cat. No.: rp156010

GRADE & PURITY Carrier Free, Bioactive, ActiBioPure™, Azide Free, High Performance, His Tag, ≥95%(SDS-PAGE)

Accession #

P09038

Protein Tag

N-His

Expression system

E. coli

Endotoxin Concentration

<1.0 EU/μg

Bioactivity

Measured in a cell proliferation assay using NIH‑3T3 mouse fibroblast cells. The ED50 for this effect is 0.44 ng/mL.

개요

Purity:>95%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description：
FGF basic (also known as FGF2 and HBGF-2) is an 18-34 kDa, heparin-binding member of the FGF superfamily of molecules. Superfamily members are characterized by the presence of a centrally placed beta -trefoil structure. FGF acidic (FGF-1) and FGF basic (FGF2) were the first two identified FGFs, and the designations acidic and basic refer to their relative isoelectric points. Human FGF basic is 288 amino acids (aa) in length. There are multiple start sites, four of which utilize atypical CUG codons, and one that initiates at an AUG start site. The four CUG start sites generate high molecular weight (HMW) FGF basic. There is a 34 kDa, 288 aa form, a 24 kDa, 210 aa form, a 22.5 kDa, 201 aa form, and a 22 kDa, 196 aa form. All are retained intracellularly, undergo extensive methylation, and possess one or more nuclear localization signals (NLS). The AUG initiating form is 18 kDa and 155 aa in length. There is no signal sequence (ss). It is, however, secreted directly through the plasma membrane via a mechanism that appears to be dependent upon tertiary structure (10). In place of a ss, there is purportedly a 9 aa N-terminal prosegment that precedes a 146 aa mature segment. Early isolations of 18 kDa bovine FGF basic yielded 146 aa molecules, an effect attributed to the presence of acid proteases. The molecule contains a heparin-binding site (aa residues 128-144), and undergoes phosphorylation at Ser117. There is also an ill-defined C-terminal NLS that may be more “functional” (or 3-dimensional) than structural. Human 146 aa FGF basic is 97% aa identical to mouse FGF basic.

Specifications

Product Name

Recombinant Human FGF basic Protein, >95% (SDS-PAGE)

동의어

Basic fibroblast growth factor | Basic fibroblast growth factor bFGF | BFGF | FGF 2 | FGF B | FGF-2 | Fgf2 | FGF2 basic | FGF2_HUMAN | FGFB | Fibroblast growth factor 2 (basic) | Fibroblast growth factor 2 | Fibroblast growth factor, basic | HBGF 2 | HBGF

등급

ActiBioPure™, Azide Free, Bioactive, Carrier Free, High Performance, His Tag

사양 및 순도

Carrier Free,Bioactive,ActiBioPure™,Azide Free,High Performance,His-Tag,≥95%(SDS-PAGE)

순도

>95% (SDS-PAGE)

생체 활성

Measured in a cell proliferation assay using NIH‑3T3 mouse fibroblast cells. The ED50 for this effect is 0.44 ng/mL.

내독소 농도

<1.0 EU/μg

표현식 시스템

E. coli

아미노산

134-288 aa

시퀀스

MGSSHHHHHHSSGLVPRGSHMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

단백질 태그

N-His

가입 번호

P09038

예상 분자량

19.4 kDa

SDS-PAGE

19.0 kDa, under reducing conditions; 19.0 kDa, under non-reducing conditions

분자 유형

Protein

보관 및 배송

모양

Lyophilized

재구성

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.

보관 조건

Store at -20°C,Avoid repeated freezing and thawing

배송

Ice chest + Ice pads

안정성 및 스토리지

Store at -20°C for 1 year. Avoid freeze / thaw cycle.

이미지

Biological activity: Recombinant Human FGF basic Protein (rp156010)

Recombinant Human FGF basic Protein (rp156010) - Biological activity

Measured in a cell proliferation assay using NIH‑3T3 mouse fibroblast cells. The ED₅₀ for this effect is 0.44 ng/mL.

SDS-PAGE: Recombinant Human FGF basic Protein (rp156010)

Recombinant Human FGF basic Protein (rp156010) - SDS-PAGE
3 μg/lane of Recombinant Human FGF basic Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 19.0 kDa.