🌎 Ship to: United States
Toggle Nav
Cart
검색
재고 상품은 당일 발송됩니다.
고급 검색
빠른 주문 SDS / CoA Structure 대량 및 사용자 정의
메뉴
계정
설정
྾
224,000+ 연구 제품 · Triple ISO certified · COA & SDS 모든 제품에 대한 사용 가능 · 주식 상품에 대한 같은 날 배송

RARB

설명Retinoic acid receptor beta

Gene and Protein Information

Gene ID5915
Uniprot Accession IDs P10826 P12891 Q00989 Q15298 Q9UN48 RAR-beta
Ensembl ID ENSP00000332296
Symbol HAP NR1B2 HAP RRB2 NR1B2 MCOPS12 RARbeta1
FamilyBelongs to the nuclear hormone receptor family. NR1 subfamily.
Sequence
MTTSGHACPVPAVNGHMTHYPATPYPLLFPPVIGGLSLPPLHGLHGHPPPSGCSTPSPATIETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETSKQECTESYEMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPSISPSSVENSGVSQSPLVQ
Show more
Homologous gene and protein info.
SpeciesGene IDGene Symbol이름 세금 IDOther Gene IDSources
Chimp745516RARBretinoic acid receptor beta9598VGNC:7111OMA, EggNOG
Macaque700485RARBretinoic acid receptor beta9544OMA, EggNOG
Mouse218772Rarbretinoic acid receptor, beta10090MGI:97857Inparanoid, OMA
Rat24706Rarbretinoic acid receptor, beta10116RGD:3535Inparanoid, OMA
Dog477045RARBretinoic acid receptor beta9615VGNC:45352Inparanoid, OMA, EggNOG
Horse100051546RARBretinoic acid receptor beta9796VGNC:22185Inparanoid, OMA, EggNOG
Opossum100024675RARBretinoic acid receptor beta13616Inparanoid, OMA
PlatypusRARBretinoic acid receptor beta [Source:HGNC Symbol;Acc:HGNC:9865]9258OMA, EggNOG
Chicken396266RARBretinoic acid receptor beta9031CGNC:8589Inparanoid, OMA, EggNOG
Anole lizard100562902rarbretinoic acid receptor beta28377Inparanoid, OMA
Xenopus100488600rarbretinoic acid receptor beta8364XB-GENE-481009Inparanoid, OMA

Associated Recombinant Proteins

이름 Specification and purityExpression systemProtein label재고상태자세히 보기

Associated Antibodies

이름 SpecificationsSpecies reactivity적용재고상태자세히 보기

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      이름 Direct Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.