| 설명 | Mas-related G-protein coupled receptor member D |
|---|
Gene and Protein Information
| Gene ID | 116512 |
|---|---|
| Uniprot Accession IDs | Q8TDS7 Q8NGK7 |
| Ensembl ID | ENSP00000310631 |
| Symbol | MRGD MRGD TGR7 |
| Family | Belongs to the G-protein coupled receptor 1 family. Mas subfamily. |
| Sequence | MNQTLNSSGTVESALNYSRGSTVHTAYLVLSSLAMFTCLCGMAGNSMVIWLLGFRMHRNPFCIYILNLAAADLLFLFSMASTLSLETQPLVNTTDKVHELMKRLMYFAYTVGLSLLTAISTQRCLSVLFPIWFKCHRPRHLSAWVCGLLWTLCLLMNGLTSSFCSKFLKFNEDRCFRVDMVQAALIMGVLTPVMTLSSLTLFVWVRRSSQQWRRQPTRLFVVVLASVLVFLICSLPLSIYWFVLYWLSLPPEMQVLCFSLSRLSSSVSSSANPVIYFLVGSRRSHRLPTRSLGTVLQQALREEPELEGGETPTVGTNEMGA Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | 이름 | 세금 ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 466686 | MRGPRD | MAS related GPR family member D | 9598 | VGNC:12584 | OMA, EggNOG |
| Macaque | 709555 | MRGPRD | MAS related GPR family member D | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 211578 | Mrgprd | MAS-related GPR, member D | 10090 | MGI:3033142 | Inparanoid, OMA, EggNOG |
| Rat | 293648 | Mrgprd | MAS related GPR family member D | 10116 | RGD:738040 | Inparanoid, OMA, EggNOG |
| Cow | 615853 | LOC615853 | mas-related G-protein coupled receptor member D | 9913 | OMA, EggNOG |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Mas proto-oncogene and Mas-related (MRGs) receptor / Mas-related g-protein coupled receptor member d
protein / G-protein coupled receptor / Class A rhodopsin like / Mas proto-oncogene and Mas-related (MRGs) receptor / Mas-related g-protein coupled receptor member d
Associated Recombinant Proteins
| 이름 | Specification and purity | Expression system | Protein label | 재고상태 | 자세히 보기 |
|---|
Associated Antibodies
| 이름 | Specifications | Species reactivity | 적용 | 재고상태 | 자세히 보기 |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| 이름 | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.