| 설명 | Baculoviral IAP repeat-containing protein 8 |
|---|
Gene and Protein Information
| Gene ID | 112401 |
|---|---|
| Uniprot Accession IDs | Q96P09 Q6IPY1 Q96RW5 |
| Ensembl ID | ENSP00000412957 |
| Symbol | ILP2 ILP2 ILP-2 hILP2 RNF136 |
| Family | Belongs to the IAP family. |
| Sequence | MTGYEARLITFGTWMYSVNKEQLARAGFYAIGQEDKVQCFHCGGGLANWKPKEDPWEQHAKWYPGCKYLLEEKGHEYINNIHLTRSLEGALVQTTKKTPSLTKRISDTIFPNPMLQEAIRMGFDFKDVKKIMEERIQTSGSNYKTLEVLVADLVSAQKDTTENELNQTSLQREISPEEPLRRLQEEKLCKICMDRHIAVVFIPCGHLVTCKQCAEAVDRCPMCSAVIDFKQRVFMS |
Protein Classes
PANTHER Classes
protein / enzyme modulator / protease inhibitor / Baculoviral IAP repeat-containing protein 8
protein / enzyme modulator / protease inhibitor / Baculoviral IAP repeat-containing protein 8
DTO Classes
protein / Enzyme modulator / Protease inhibitor / Baculoviral IAP repeat-containing protein 8
protein / Enzyme modulator / Protease inhibitor / Baculoviral IAP repeat-containing protein 8
Associated Recombinant Proteins
| 이름 | Specification and purity | Expression system | Protein label | 재고상태 | 자세히 보기 |
|---|
Associated Antibodies
| 이름 | 사양 | Species reactivity | 적용 | 재고상태 | 자세히 보기 |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| 이름 | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.