🌎 배송지: United States
Toggle Nav
Cart
검색
재고 상품은 당일 발송됩니다.
고급 검색
빠른 주문 SDS / CoA Structure 대량 및 사용자 정의
메뉴
계정
설정
྾
340,000+ 연구 제품 · Triple ISO certified · COA & SDS 모든 제품에 대한 사용 가능 · 주식 상품에 대한 같은 날 배송

BCAM

설명Basal cell adhesion molecule

Gene and Protein Information

Gene ID4059
Uniprot Accession IDs P50895 A8MYF9 A9YWT5 A9YWT6 Q86VC7
Ensembl ID ENSP00000270233
Symbol LU MSK19 AU LU CD239 MSK19
Sequence
MEPPDAPAQARGAPRLLLLAVLLAAHPDAQAEVRLSVPPLVEVMRGKSVILDCTPTGTHDHYMLEWFLTDRSGARPRLASAEMQGSELQVTMHDTRGRSPPYQLDSQGRLVLAEAQVGDERDYVCVVRAGAAGTAEATARLNVFAKPEATEVSPNKGTLSVMEDSAQEIATCNSRNGNPAPKITWYRNGQRLEVPVEMNPEGYMTSRTVREASGLLSLTSTLYLRLRKDDRDASFHCAAHYSLPEGRHGRLDSPTFHLTLHYPTEHVQFWVGSPSTPAGWVREGDTVQLLCRGDGSPSPEYTLFRLQDEQEEVLNVNLEGNLTLEGVTRGQSGTYGCRVEDYDAADDVQLSKTLELRVAYLDPLELSEGKVLSLPLNSSAVVNCSVHGLPTPALRWTKDSTPLGDGPMLSLSSITFDSNGTYVCEASLPTVPVLSRTQNFTLLVQGSPELKTAEIEPKADGSWREGDEVTLICSARGHPDPKLSWSQLGGSPAEPIPGRQGWVSSSLTLKVTSALSRDGISCEASNPHGNKRHVFHFGTVSPQTSQAGVAVMAVAVSVGLLLLVVAVFYCVRRKGGPCCRQRREKGAPPPGEPGLSHSGSEQPEQTGLLMGGASGGARGGSGGFGDEC
Show more
Homologous gene and protein info.
SpeciesGene IDGene Symbol이름 세금 IDOther Gene IDSources
Chimp744276BCAMbasal cell adhesion molecule 9598VGNC:2582OMA, EggNOG
Macaque714568BCAMbasal cell adhesion molecule (Lutheran blood group)9544Inparanoid, OMA, EggNOG
Mouse57278Bcambasal cell adhesion molecule10090MGI:1929940Inparanoid, OMA, EggNOG
Rat78958Bcambasal cell adhesion molecule (Lutheran blood group)10116RGD:68378Inparanoid, OMA, EggNOG
Dog484456BCAMbasal cell adhesion molecule9615VGNC:49023Inparanoid, OMA, EggNOG
Horse100070622BCAMbasal cell adhesion molecule9796VGNC:51000Inparanoid, OMA, EggNOG
Cow282862BCAMbasal cell adhesion molecule9913VGNC:49138Inparanoid, OMA, EggNOG
Pig100738241BCAMbasal cell adhesion molecule (Lutheran blood group)9823OMA, EggNOG
Anole lizard103281770bcambasal cell adhesion molecule (Lutheran blood group)28377Inparanoid, OMA, EggNOG
Xenopus100036718bcambasal cell adhesion molecule (Lutheran blood group)8364XB-GENE-921467Inparanoid, OMA, EggNOG
Zebrafish767689bcambasal cell adhesion molecule (Lutheran blood group)7955ZDB-GENE-060929-620Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    cell adhesion molecule    /    immunoglobulin superfamily cell adhesion molecule    /    Basal cell adhesion molecule
protein    /    cell adhesion molecule    /    receptor    /    Basal cell adhesion molecule
DTO Classes
protein    /    Cell adhesion    /    Immunoglobulin superfamily cell adhesion molecule    /    Basal cell adhesion molecule

Associated Recombinant Proteins

이름 Specification and purityExpression systemProtein label재고상태자세히 보기

Associated Antibodies

이름 SpecificationsSpecies reactivity적용재고상태자세히 보기

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      이름 Direct Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      당사는 웹사이트가 올바르게 작동하도록 하고, 허용되는 경우 귀하의 경험을 개선하기 위해 쿠키를 사용합니다. 설정에서 언제든지 환경설정을 관리하실 수 있습니다. 자세한 내용은 쿠키 정책을 참조하십시오.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.