🌎 Ship to: United States
Toggle Nav
Cart
검색
재고 상품은 당일 발송됩니다.
고급 검색
빠른 주문 SDS / CoA Structure 대량 및 사용자 정의
메뉴
계정
설정
྾
224,000+ 연구 제품 · Triple ISO certified · COA & SDS 모든 제품에 대한 사용 가능 · 주식 상품에 대한 같은 날 배송

BAD

설명Bcl2-associated agonist of cell death

Gene and Protein Information

Gene ID572
Uniprot Accession IDs Q92934 O14803 Q6FH21 BAD
Ensembl ID ENSP00000378040
Symbol BBC6 BCL2L8 BBC2 BCL2L8
FamilyBelongs to the Bcl-2 family.
Sequence
MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ
Homologous gene and protein info.
SpeciesGene IDGene Symbol이름 세금 IDOther Gene IDSources
Chimp100615623BADBCL2 associated agonist of cell death9598VGNC:1614OMA, EggNOG
Macaque717740BADBCL2 associated agonist of cell death9544Inparanoid, OMA, EggNOG
Mouse12015BadBCL2-associated agonist of cell death10090MGI:1096330Inparanoid, OMA, EggNOG
Rat64639BadBCL2-associated agonist of cell death10116RGD:620103Inparanoid, OMA
Dog483763BADBCL2 associated agonist of cell death9615VGNC:38362Inparanoid, OMA, EggNOG
Horse100055447BADBCL2 associated agonist of cell death9796VGNC:15752Inparanoid, OMA, EggNOG
Cow615013BADBCL2 associated agonist of cell death9913VGNC:26404Inparanoid, OMA, EggNOG
Pig100521065BADBCL2 associated agonist of cell death9823OMA, EggNOG

Associated Recombinant Proteins

이름 Specification and purityExpression systemProtein label재고상태자세히 보기

Associated Antibodies

이름 SpecificationsSpecies reactivity적용재고상태자세히 보기

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      이름 Direct Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.