The store will not work correctly when cookies are disabled.
JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.
· · COA & SDS 모든 제품에 대한 사용 가능 · 주식 상품에 대한 같은 날 배송
DUSP23 설명 Dual specificity protein phosphatase 23
Gene and Protein Information Gene ID 54935 Uniprot Accession IDs Q9BVJ7 Q9NX48 Ensembl ID ENSP00000357087 Symbol LDP3 VHZ VHZ LDP3 MOSP LDP-3 DUSP25 Family Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily. Sequence MGVQPPNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERGPPHSDSCPGLTLHRLRIPDFCPPAPDQIDRFVQIVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGDAIAEIRRLRPGSIETYEQEKAVFQFYQRTK
Homologous gene and protein info.
Species Gene ID Gene Symbol 이름 세금 ID Other Gene ID Sources Chimp 746364 DUSP23 dual specificity phosphatase 23 9598 VGNC:524 OMA, EggNOG Macaque 719474 DUSP23 dual specificity phosphatase 23 9544 Inparanoid, OMA, EggNOG Mouse 68440 Dusp23 dual specificity phosphatase 23 10090 MGI:1915690 Inparanoid, OMA, EggNOG Rat 360881 Dusp23 dual specificity phosphatase 23 10116 RGD:1309202 Inparanoid, OMA, EggNOG Horse 100053524 DUSP23 dual specificity phosphatase 23 9796 VGNC:17354 Inparanoid, OMA, EggNOG Cow 513978 DUSP23 dual specificity phosphatase 23 9913 VGNC:28257 Inparanoid, OMA, EggNOG Opossum 100029973 DUSP23 dual specificity phosphatase 23 13616 Inparanoid, OMA, EggNOG Anole lizard 100563895 dusp23 dual specificity phosphatase 23 28377 Inparanoid, OMA, EggNOG Xenopus 496838 dusp23 dual specificity phosphatase 23 8364 XB-GENE-967743 Inparanoid, OMA, EggNOG Zebrafish 436735 dusp23b dual specificity phosphatase 23b 7955 ZDB-GENE-040718-163 OMA, EggNOG
Associated Recombinant Proteins 이름 Specification and purity Expression system Protein label 재고상태 자세히 보기
Associated Antibodies
이름 Specifications Species reactivity 적용 재고상태 자세히 보기
Associated Approved Drugs Associated Active Ligands Associated Diseases 이름 Direct Associated Targets Disease Type Mondoid
We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our
Cookie Policy. 설정 모두 동의 Decline
Shall we send you a message when we have discounts available?
Remind me later Allow
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.
