| 설명 | ATP-binding cassette sub-family F member 2 |
|---|
Gene and Protein Information
| Gene ID | 10061 |
|---|---|
| Uniprot Accession IDs | Q9UG63 O60864 Q75MJ0 Q75MJ1 Q96TE8 |
| Ensembl ID | ENSP00000222388 |
| Symbol | ABC28 HUSSY18 HUSSY-18 EST133090 |
| Family | Belongs to the ABC transporter superfamily. ABCF family. EF3 subfamily. |
| Sequence | MPSDLAKKKAAKKKEAAKARQRPRKGHEENGDVVTEPQVAEKNEANGRETTEVDLLTKELEDFEMKKAAARAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNSGRRYGLIGLNGIGKSMLLSAIGKREVPIPEHIDIYHLTREMPPSDKTPLHCVMEVDTERAMLEKEAERLAHEDAECEKLMELYERLEELDADKAEMRASRILHGLGFTPAMQRKKLKDFSGGWRMRVALARALFIRPFMLLLDEPTNHLDLDACVWLEEELKTFKRILVLVSHSQDFLNGVCTNIIHMHNKKLKYYTGNYDQYVKTRLELEENQMKRFHWEQDQIAHMKNYIARFGHGSAKLARQAQSKEKTLQKMMASGLTERVVSDKTLSFYFPPCGKIPPPVIMVQNVSFKYTKDGPCIYNNLEFGIDLDTRVALVGPNGAGKSTLLKLLTGELLPTDGMIRKHSHVKIGRYHQHLQEQLDLDLSPLEYMMKCYPEIKEKEEMRKIIGRYGLTGKQQVSPIRNLSDGQKCRVCLAWLAWQNPHMLFLDEPTNHLDIETIDALADAINEFEGGMMLVSHDFRLIQQVAQEIWVCEKQTITKWPGDILAYKEHLKSKLVDEEPQLTKRTHNV Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | 이름 | 세금 ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 27407 | Abcf2 | ATP-binding cassette, sub-family F (GCN20), member 2 | 10090 | MGI:1351657 | Inparanoid, OMA |
| Horse | 100063507 | ABCF2 | ATP binding cassette subfamily F member 2 | 9796 | VGNC:14928 | Inparanoid, OMA |
| Cow | 513061 | ABCF2 | ATP binding cassette subfamily F member 2 | 9913 | VGNC:25481 | Inparanoid, OMA |
| Opossum | 100015529 | ABCF2 | ATP binding cassette subfamily F member 2 | 13616 | Inparanoid, OMA | |
| Zebrafish | 336770 | abcf2a | ATP-binding cassette, sub-family F (GCN20), member 2a | 7955 | ZDB-GENE-030131-8714 | Inparanoid, OMA |
| C. elegans | 176771 | abcf-2 | ABC transporter, class F | 6239 | Inparanoid, OMA | |
| S.cerevisiae | 856758 | ARB1 | ATP-binding cassette family ATPase ARB1 | 4932 | S000000838 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / ATP-binding cassette (ABC) transporter / ATP-binding cassette sub-family F member 2
protein / nucleic acid binding / translation elongation factor / ATP-binding cassette sub-family F member 2
protein / nucleic acid binding / hydrolase / ATP-binding cassette sub-family F member 2
protein / nucleic acid binding / ATP-binding cassette (ABC) transporter / ATP-binding cassette sub-family F member 2
protein / nucleic acid binding / translation elongation factor / ATP-binding cassette sub-family F member 2
protein / nucleic acid binding / hydrolase / ATP-binding cassette sub-family F member 2
Associated Recombinant Proteins
| 이름 | Specification and purity | Expression system | Protein label | 재고상태 | 자세히 보기 |
|---|
Associated Antibodies
| 이름 | Specifications | Species reactivity | 적용 | 재고상태 | 자세히 보기 |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| 이름 | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.