🌎 Ship to: United States
Toggle Nav
Cart
검색
재고 상품은 당일 발송됩니다.
고급 검색
빠른 주문 SDS / CoA Structure 대량 및 사용자 정의
메뉴
계정
설정
྾
224,000+ 연구 제품 · Triple ISO certified · COA & SDS 모든 제품에 대한 사용 가능 · 주식 상품에 대한 같은 날 배송

EIF4EBP1

설명Eukaryotic translation initiation factor 4E-binding protein 1

Gene and Protein Information

Gene ID1978
Uniprot Accession IDs Q13541 B2R502 D3DSW8 Q6IBN3 4E-BP1
Ensembl ID ENSP00000340691
Symbol BP-1 4EBP1 4E-BP1 PHAS-I
FamilyBelongs to the eIF4E-binding protein family.
Sequence
MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI
Homologous gene and protein info.
SpeciesGene IDGene Symbol이름 세금 IDOther Gene IDSources
Chimp464114EIF4EBP1eukaryotic translation initiation factor 4E binding protein 19598VGNC:884OMA, EggNOG
Macaque703628EIF4EBP1eukaryotic translation initiation factor 4E binding protein 19544Inparanoid, EggNOG
Mouse13685Eif4ebp1eukaryotic translation initiation factor 4E binding protein 110090MGI:103267Inparanoid, OMA, EggNOG
Rat116636Eif4ebp1eukaryotic translation initiation factor 4E binding protein 110116RGD:620259Inparanoid, OMA, EggNOG
Dog475590EIF4EBP1eukaryotic translation initiation factor 4E binding protein 19615VGNC:40286Inparanoid, OMA, EggNOG
Horse100057875EIF4EBP1eukaryotic translation initiation factor 4E binding protein 19796VGNC:17505Inparanoid, OMA, EggNOG
Cow509613EIF4EBP1eukaryotic translation initiation factor 4E binding protein 19913VGNC:28412Inparanoid, OMA, EggNOG
Pig100627508EIF4EBP1eukaryotic translation initiation factor 4E binding protein 19823Inparanoid, EggNOG
Opossum100029774EIF4EBP1eukaryotic translation initiation factor 4E binding protein 113616Inparanoid, EggNOG
Chicken426773EIF4EBP1eukaryotic translation initiation factor 4E binding protein 19031CGNC:2329Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    translation factor    /    Eukaryotic translation initiation factor 4E-binding protein 1
DTO Classes
protein    /    Nucleic acid binding    /    RNA binding protein    /    Translation factor    /    Eukaryotic translation initiation factor 4E-binding protein 1

Associated Recombinant Proteins

이름 Specification and purityExpression systemProtein label재고상태자세히 보기

Associated Antibodies

이름 SpecificationsSpecies reactivity적용재고상태자세히 보기

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      이름 Direct Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.