🌎 배송지: United States
Toggle Nav
Cart
검색
재고 상품은 당일 발송됩니다.
고급 검색
빠른 주문 SDS / CoA Structure 대량 및 사용자 정의
메뉴
계정
설정
྾
340,000+ 연구 제품 · Triple ISO certified · COA & SDS 모든 제품에 대한 사용 가능 · 주식 상품에 대한 같은 날 배송

BCAS2

설명Pre-mRNA-splicing factor SPF27

Gene and Protein Information

Gene ID10286
Uniprot Accession IDs O75934 Q6FGS0
Ensembl ID ENSP00000358554
Symbol DAM1 DAM1 SPF27 Snt309
FamilyBelongs to the SPF27 family.
Sequence
MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF
Homologous gene and protein info.
SpeciesGene IDGene Symbol이름 세금 IDOther Gene IDSources
Chimp457143BCAS2BCAS2, pre-mRNA processing factor9598VGNC:14799OMA, EggNOG
Mouse68183Bcas2breast carcinoma amplified sequence 210090MGI:1915433Inparanoid, OMA, EggNOG
Rat295334Bcas2BCAS2, pre-mRNA processing factor10116RGD:1306485Inparanoid, OMA, EggNOG
Dog475805BCAS2BCAS2, pre-mRNA processing factor9615VGNC:38399Inparanoid, OMA, EggNOG
Horse100065284BCAS2BCAS2, pre-mRNA processing factor9796VGNC:15783Inparanoid, OMA, EggNOG
Cow507944BCAS2BCAS2, pre-mRNA processing factor9913Inparanoid, OMA, EggNOG
Pig100154006BCAS2BCAS2, pre-mRNA processing factor9823Inparanoid, OMA, EggNOG
Opossum100030739BCAS2BCAS2, pre-mRNA processing factor13616Inparanoid, OMA, EggNOG
Platypus100074712BCAS2BCAS2, pre-mRNA processing factor9258Inparanoid, OMA, EggNOG
Chicken419884BCAS2breast carcinoma amplified sequence 29031CGNC:1446Inparanoid, OMA, EggNOG
Anole lizard100562552bcas2BCAS2, pre-mRNA processing factor28377Inparanoid, OMA, EggNOG
Xenopus394520bcas2breast carcinoma amplified sequence 28364XB-GENE-959514Inparanoid, OMA, EggNOG
Zebrafish493614bcas2BCAS2, pre-mRNA processing factor7955ZDB-GENE-030408-5Inparanoid, OMA
C. elegans188435bcas-2BCAS splicing factor homolog6239OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    mRNA splicing factor    /    Pre-mRNA-splicing factor SPF27
DTO Classes
protein    /    Nucleic acid binding    /    RNA binding protein    /    mRNA processing factor    /    mRNA splicing factor    /    Pre-mRNA-splicing factor SPF27

Associated Recombinant Proteins

이름 Specification and purityExpression systemProtein label재고상태자세히 보기

Associated Antibodies

이름 사양Species reactivity적용재고상태자세히 보기

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      이름 Direct Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      당사는 웹사이트가 올바르게 작동하도록 하고, 허용되는 경우 귀하의 경험을 개선하기 위해 쿠키를 사용합니다. 설정에서 언제든지 환경설정을 관리하실 수 있습니다. 자세한 내용은 쿠키 정책을 참조하십시오.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.