| 설명 | Taste receptor type 2 member 19 |
|---|
Gene and Protein Information
| Gene ID | 259294 |
|---|---|
| Uniprot Accession IDs | P59542 Q3MIJ4 Q645X8 |
| Ensembl ID | ENSP00000375091 |
| Symbol | TAS2R23 TAS2R48 T2R19 T2R23 T2R48 MSTP058 TAS2R23 TAS2R48 |
| Family | Belongs to the G-protein coupled receptor T2R family. |
| Sequence | MMCFLLIISSILVVFAFVLGNVANGFIALVNVIDWVNTRKISSAEQILTALVVSRIGLLWVMLFLWYATVFNSALYGLEVRIVASNAWAVTNHFSMWLAASLSIFCLLKIANFSNLISLHLKKRIKSVVLVILLGPLVFLICNLAVITMDERVWTKEYEGNVTWKIKLRNAIHLSSLTVTTLANLIPFTLSLICFLLLICSLCKHLKKMRLHSKGSQDPSTKVHIKALQTVTSFLMLFAIYFLCIITSTWNLRTQQSKLVLLLCQTVAIMYPSFHSFILIMGSRKLKQTFLSVLWQMTR |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | 이름 | 세금 ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Dog | 100271744 | CAFA-T2R43 | bitter taste receptor Cafa-T2R43 | 9615 | Inparanoid, OMA | |
| Horse | 100065729 | LOC100065729 | taste receptor type 2 member 50-like | 9796 | Inparanoid, OMA | |
| Cow | 664639 | TAS2R46 | taste receptor, type 2, member 46 | 9913 | Inparanoid, OMA |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Taste 2 receptor / Taste receptor type 2 member 19
protein / G-protein coupled receptor / Class A rhodopsin like / Taste 2 receptor / Taste receptor type 2 member 19
Associated Recombinant Proteins
| 이름 | Specification and purity | Expression system | Protein label | 재고상태 | 자세히 보기 |
|---|
Associated Antibodies
| 이름 | Specifications | Species reactivity | 적용 | 재고상태 | 자세히 보기 |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| 이름 | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.