The store will not work correctly when cookies are disabled.
JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.
· · COA & SDS 모든 제품에 대한 사용 가능 · 주식 상품에 대한 같은 날 배송
SUB1 설명 Activated RNA polymerase II transcriptional coactivator p15
Gene and Protein Information Gene ID 10923 Uniprot Accession IDs P53999 Q96L29 Ensembl ID ENSP00000265073 Symbol PC4 RPO2TC1 P15 PC4 p14 Family Belongs to the transcriptional coactivator PC4 family. Sequence MPKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL
Homologous gene and protein info.
Species Gene ID Gene Symbol 이름 세금 ID Other Gene ID Sources Mouse 20024 Sub1 SUB1 homolog (S. cerevisiae) 10090 MGI:104811 Inparanoid, OMA, EggNOG Rat 192269 Sub1 SUB1 homolog, transcriptional regulator 10116 RGD:621582 Inparanoid, OMA, EggNOG Dog 479283 SUB1 SUB1 homolog, transcriptional regulator 9615 OMA, EggNOG Horse 100068496 SUB1 SUB1 homolog, transcriptional regulator 9796 VGNC:23741 Inparanoid, OMA, EggNOG Cow 533984 SUB1 SUB1 homolog, transcriptional regulator 9913 VGNC:35454 Inparanoid, OMA, EggNOG Opossum 100015659 SUB1 SUB1 homolog, transcriptional regulator 13616 Inparanoid, OMA, EggNOG Platypus 100092955 SUB1 SUB1 homolog, transcriptional regulator 9258 Inparanoid, OMA, EggNOG Chicken 427425 SUB1 SUB1 homolog, transcriptional regulator 9031 CGNC:2359 Inparanoid, OMA, EggNOG Anole lizard 100563239 sub1 SUB1 homolog, transcriptional regulator 28377 Inparanoid, OMA, EggNOG Xenopus 448190 sub1 SUB1 homolog, transcriptional regulator 8364 XB-GENE-1015843 Inparanoid, OMA, EggNOG Zebrafish 553561 sub1a SUB1 homolog, transcriptional regulator a 7955 ZDB-GENE-050522-151 Inparanoid, OMA C. elegans 188475 T13F2.2 Putative RNA polymerase II transcriptional coactivator 6239 Inparanoid, OMA Fruitfly 34120 Ssb-c31a Single stranded-binding protein c31A 7227 FBgn0015299 Inparanoid, EggNOG
Associated Recombinant Proteins 이름 Specification and purity Expression system Protein label 재고상태 자세히 보기
Associated Antibodies
이름 사양 Species reactivity 적용 재고상태 자세히 보기
Associated Approved Drugs Associated Active Ligands Associated Diseases 이름 Direct Associated Targets Disease Type Mondoid
당사는 웹사이트가 올바르게 작동하도록 하고, 허용되는 경우 귀하의 경험을 개선하기 위해 쿠키를 사용합니다. 설정에서 언제든지 환경설정을 관리하실 수 있습니다. 자세한 내용은
쿠키 정책 을 참조하십시오.
설정 모두 동의 Decline
Shall we send you a message when we have discounts available?
Remind me later Allow
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.
