| 설명 | Putative gonadotropin-releasing hormone II receptor |
|---|
Gene and Protein Information
| Gene ID | 114814 |
|---|---|
| Uniprot Accession IDs | Q96P88 E7EN27 Q8TCX8 GnRH II receptor |
| Symbol | GnRH-II-R |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence | MSAGNGTPWDATWNITVQWLAVDIACRTLMFLKLMATYSAAFLPVVIGLDRQAAVLNPLGSRSGVRKLLGAAWGLSFLLAFPQLFLFHTVHCAGPVPFTQCVTKGSFKAQWQETTYNLFTFCCLFLLPLTAMAICYSRIVLSVSRPQTRKGSHAPAGEFALPRSFDNCPRVRLRALRLALLILLTFILCWTPYYLLGMWYWFSPTMLTEVPPSLSHILFLLGLLNAPLDPLLYGAFTLGCRRGHQELSIDSSKEGSGRMLQEEIHAFRQLEVQKTVTSRRAGETKGISITSI |
Protein Classes
PANTHER Classes
protein / receptor / G-protein coupled receptor / Putative gonadotropin-releasing hormone ii receptor
protein / receptor / G-protein coupled receptor / Putative gonadotropin-releasing hormone ii receptor
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Gonadotrophin-releasing hormone receptor / Putative gonadotropin-releasing hormone ii receptor
protein / G-protein coupled receptor / Class A rhodopsin like / Gonadotrophin-releasing hormone receptor / Putative gonadotropin-releasing hormone ii receptor
Associated Recombinant Proteins
| 이름 | Specification and purity | Expression system | Protein label | 재고상태 | 자세히 보기 |
|---|
Associated Antibodies
| 이름 | Specifications | Species reactivity | 적용 | 재고상태 | 자세히 보기 |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| 이름 | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.