🌎 Ship to: United States
Toggle Nav
Cart
검색
재고 상품은 당일 발송됩니다.
고급 검색
빠른 주문 SDS / CoA Structure 대량 및 사용자 정의
메뉴
계정
설정
྾
224,000+ 연구 제품 · Triple ISO certified · COA & SDS 모든 제품에 대한 사용 가능 · 주식 상품에 대한 같은 날 배송

FABP1

설명Fatty acid-binding protein, liver

Gene and Protein Information

Gene ID2168
Uniprot Accession IDs P07148
Ensembl ID ENSP00000295834
Symbol FABPL FABPL L-FABP
FamilyBelongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
Sequence
MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI
Homologous gene and protein info.
SpeciesGene IDGene Symbol이름 세금 IDOther Gene IDSources
Chimp736471FABP1fatty acid binding protein 19598VGNC:7696OMA, EggNOG
Mouse14080Fabp1fatty acid binding protein 1, liver10090MGI:95479Inparanoid, OMA, EggNOG
Rat24360Fabp1fatty acid binding protein 110116RGD:2590Inparanoid, OMA, EggNOG
Dog403619FABP1fatty acid binding protein 19615VGNC:40558Inparanoid, OMA, EggNOG
Horse100052746FABP1fatty acid binding protein 19796VGNC:17765Inparanoid, OMA, EggNOG
Cow327700FABP1fatty acid binding protein 19913VGNC:28695Inparanoid, OMA, EggNOG
Pig445535FABP1fatty acid binding protein 19823Inparanoid, OMA, EggNOG
OpossumFABP1fatty acid binding protein 1 [Source:HGNC Symbol;Acc:HGNC:3555]13616Inparanoid, EggNOG
PlatypusFABP1fatty acid binding protein 1 [Source:HGNC Symbol;Acc:HGNC:3555]9258OMA, EggNOG
Chicken374015FABP1fatty acid binding protein 19031CGNC:11895OMA, EggNOG
Anole lizard100562032fabp1fatty acid binding protein 128377Inparanoid, OMA, EggNOG
Xenopus100144636fabp1fatty acid binding protein 18364XB-GENE-481608Inparanoid, OMA, EggNOG
Zebrafish791610fabp1afatty acid binding protein 1a, liver7955ZDB-GENE-020318-3Inparanoid, OMA

Associated Recombinant Proteins

이름 Specification and purityExpression systemProtein label재고상태자세히 보기

Associated Antibodies

이름 SpecificationsSpecies reactivity적용재고상태자세히 보기

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      이름 Direct Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.