🌎 배송지: United States
Toggle Nav
Cart
검색
재고 상품은 당일 발송됩니다.
고급 검색
빠른 주문 SDS / CoA Structure 대량 및 사용자 정의
메뉴
계정
설정
྾
340,000+ 연구 제품 · Triple ISO certified · COA & SDS 모든 제품에 대한 사용 가능 · 주식 상품에 대한 같은 날 배송

P2RY12

설명P2Y purinoceptor 12

Gene and Protein Information

Gene ID64805
Uniprot Accession IDs Q9H244 D3DNJ5 Q546J7 P2Y12
Ensembl ID ENSP00000307259
Symbol HORK3 HORK3 P2Y12 ADPG-R BDPLT8 SP1999 P2T(AC) P2Y(AC) P2Y(12)R P2Y(ADP) P2Y(cyc)
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITIDRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM
Show more
Homologous gene and protein info.
SpeciesGene IDGene Symbol이름 세금 IDOther Gene IDSources
Macaque710036P2RY12purinergic receptor P2Y129544Inparanoid, OMA, EggNOG
Mouse70839P2ry12purinergic receptor P2Y, G-protein coupled 1210090MGI:1918089Inparanoid, OMA, EggNOG
Rat64803P2ry12purinergic receptor P2Y1210116RGD:621681Inparanoid, OMA, EggNOG
Dog442958P2RY12purinergic receptor P2Y129615VGNC:44214Inparanoid, OMA, EggNOG
Horse100630046P2RY12purinergic receptor P2Y129796VGNC:21110Inparanoid, OMA, EggNOG
Cow408007P2RY12purinergic receptor P2Y129913VGNC:32525Inparanoid, OMA, EggNOG
Pig503659P2RY12purinergic receptor P2Y129823OMA, EggNOG
Opossum100618708P2RY12purinergic receptor P2Y1213616Inparanoid, OMA, EggNOG
Platypus100682030P2RY12purinergic receptor P2Y129258Inparanoid, OMA, EggNOG
Anole lizard103278184p2ry12purinergic receptor P2Y1228377Inparanoid, OMA
Xenopus100493410p2ry12purinergic receptor P2Y, G-protein coupled, 128364XB-GENE-947453Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    P2y purinoceptor 12
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Purinoceptor    /    P2Y receptor    /    P2y purinoceptor 12

Associated Recombinant Proteins

이름 Specification and purityExpression systemProtein label재고상태자세히 보기

Associated Antibodies

이름 사양Species reactivity적용재고상태자세히 보기

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      이름 Direct Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      당사는 웹사이트가 올바르게 작동하도록 하고, 허용되는 경우 귀하의 경험을 개선하기 위해 쿠키를 사용합니다. 설정에서 언제든지 환경설정을 관리하실 수 있습니다. 자세한 내용은 쿠키 정책을 참조하십시오.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.